DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpina1a and Spn42Dd

DIOPT Version :9

Sequence 1:NP_001239498.1 Gene:Serpina1a / 20700 MGIID:891971 Length:436 Species:Mus musculus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:362 Identity:101/362 - (27%)
Similarity:173/362 - (47%) Gaps:21/362 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse    81 ELVHQSNTS-NIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSEADIHKSFQHLLQTL 144
            :|:.:|:|: |:..|||||.|..:|:.:|::|.|..::...|  .|....:..:...:..||..|
  Fly    23 QLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSAL--GLPSEDKEAVAARYGALLNDL 85

Mouse   145 NRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAKKVINDFVEKGTQGK 209
            ...:....|...|.::||:...|.:.:....:..:::|..|::......|.:.||.:|...|.||
  Fly    86 QGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGPVAAERINQWVLDQTSGK 150

Mouse   210 IAEAVK--KLDQDTVFALANYILFKGKWKKPFDPENTEEAEFHVDESTTVKVPMMTLSGMLHVHH 272
            |...:.  .:..|....|.|.|.|||:|:..|||..|..:.|.|..:.:|.|.||...|....::
  Fly   151 IKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSVPVQMMAQMGTFRANY 215

Mouse   273 CSTLSSWVLLMDYA-GNATAVFLLPDDGK-MQHLEQTL---SKELISKFLLNRRRRLAQIHFPRL 332
            ...|.:.|:.:.|. .|.:....||.:.: :..||:.:   ::.|::|.:        .:..|:.
  Fly   216 FRDLDAQVIELPYLNSNLSMTIFLPREVEGLSALEEKIVGFARPLVAKEV--------YLKLPKF 272

Mouse   333 SISGEYNLKTLMSPLGITRIFNNGADLSGITEENAPLKLSQAVHKAVLTIDETGTEAAAVTVLQM 397
            .|.....||..:..|||..:|.:.:||||:..:.:..|:||..|||.|.::|.|.|||..|.:.:
  Fly   273 KIEFRDELKETLEKLGIRELFTDKSDLSGLFADKSGGKVSQVSHKAFLEVNEEGAEAAGATSVAV 337

Mouse   398 VPMS-MPPILRFDHPFLFIIFEEHTQSPIFLGKVVDP 433
            ...: ....|..||||.|:|.:.:|  ..|.|:||.|
  Fly   338 TNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpina1aNP_001239498.1 SERPIN 76..433 CDD:214513 100/360 (28%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 98/357 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.