DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sparc and Fs

DIOPT Version :9

Sequence 1:NP_033268.1 Gene:Sparc / 20692 MGIID:98373 Length:302 Species:Mus musculus
Sequence 2:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster


Alignment Length:90 Identity:27/90 - (30%)
Similarity:38/90 - (42%) Gaps:16/90 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    69 NPCQNHHCKHGKVCELDESNTPMCV-CQDPTSCP--------APIGEFEKVCSNDNKTFDSSCHF 124
            |.|...||.:|..|..|:...|.|: |:  ..||        :...|.:.||..|.||:.|:|..
  Fly   606 NSCSGVHCLNGLTCVEDQYLMPHCIACR--IECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDI 668

Mouse   125 FATKCTLEGTKKGHKLHLDYIGPCK 149
            ....|     |.|..:.:.|.|||:
  Fly   669 NRMIC-----KIGRSIAVAYPGPCR 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SparcNP_033268.1 FSL_SPARC 70..151 CDD:238649 26/89 (29%)
EFh_SPARC_SPARC 154..293 CDD:320014
EF-hand motif 226..259 CDD:320014
EF-hand motif 261..293 CDD:320014
FsNP_652376.2 KAZAL 564..604 CDD:197624
KAZAL_FS 654..687 CDD:238052 12/37 (32%)
KAZAL_FS 723..767 CDD:238052
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4004
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.