DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox7 and Sox100B

DIOPT Version :9

Sequence 1:NP_035576.1 Gene:Sox7 / 20680 MGIID:98369 Length:380 Species:Mus musculus
Sequence 2:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster


Alignment Length:481 Identity:110/481 - (22%)
Similarity:148/481 - (30%) Gaps:218/481 - (45%)


- Green bases have known domain annotations that are detailed below.


Mouse    38 DKSSESRIRRPMNAFMVWAKDERKRLAVQNPDLHNAELSKMLGKSWKALTLSQKRPYVDEAERLR 102
            |:..| .|:||||||||||:..|:.::.|.|.|.|:||||.|||.||.|..|.|:|:::.||:||
  Fly    71 DRKKE-HIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLR 134

Mouse   103 LQHMQDYPNYKYRPRRKK------------------------------------QGKRLCKRVDP 131
            :.|.|::|:|||:|||||                                    .|:|   |...
  Fly   135 MTHKQEHPDYKYQPRRKKARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQR---RAGK 196

Mouse   132 GFLLSSLSRDQNTLPEKNGIGRGEKE-------------------------DRGEYSPGATLPGL 171
            |...:.|....:|:...| :|....:                         :.|..||.:|...:
  Fly   197 GNAAADLGSCASTISHAN-VGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSM 260

Mouse   172 HSC---------------------------------------------------------YR--- 176
            .|.                                                         |:   
  Fly   261 SSLTPPATPYNVAPSNAKASAANNPSLLLRQLSEPVANAGDGYGVLLEAGREYVAIGEVNYQGQS 325

Mouse   177 -------EGAAAA---------------PGSVDTYP-YGLPT----------------------- 195
                   ||..|.               .||..:|| |..|.                       
  Fly   326 AGVQSGAEGGGAGQEMDFLENINGYGGYTGSRVSYPAYSYPANGGHFATEEQQQQQALQASEALN 390

Mouse   196 -PPEMSPLDALEPEQTFFSSSC-QEEHGHPHH---LPHLPGPPYSPEFTPSPLHCSHPLGSLALG 255
             .|..:.:|..|.:|.|..... ..:|.||||   |.|             |||.|.||.|.|..
  Fly   391 YKPAAADIDPKEIDQYFMDQMLPMTQHHHPHHTHPLHH-------------PLHHSPPLNSSASL 442

Mouse   256 QSPGVSMMSSVSGCPPSPAYYSHATYHPL------HPNLQAHLGQLSPPPEHPGFDTLDQLSQVE 314
            .    |..||.|...|...||.|..|.|.      :||.         .|:.|..:  ...|...
  Fly   443 S----SACSSASSQQPVAEYYEHLGYSPAASSASQNPNF---------GPQQPYAN--GAASMTP 492

Mouse   315 LLGD-------MDRNEFDQYLNTPGH 333
            .|||       ..:.:..|:.|...|
  Fly   493 TLGDPAPQQELQSQQQEQQHQNPSQH 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox7NP_035576.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..43 1/4 (25%)
SOX-TCF_HMG-box 44..115 CDD:238684 38/70 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..167 6/52 (12%)
Sox_C_TAD 175..378 CDD:288887 51/226 (23%)
Required for beta-catenin-binding 323..328 1/4 (25%)
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 37/69 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.