DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox5 and Sox15

DIOPT Version :9

Sequence 1:XP_006506994.1 Gene:Sox5 / 20678 MGIID:98367 Length:792 Species:Mus musculus
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:415 Identity:102/415 - (24%)
Similarity:169/415 - (40%) Gaps:105/415 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse   384 GKLLGLPQGNLGA-AVSPTSIHTDKSTNSPPPKSKDEVAQPLNLSAKPKTSDGKSPASPTSPHMP 447
            |:|:.....:.|. .|...|.|:..|.:||..:|.....:.||.:.....|...||    .|.:.
  Fly    49 GRLMHESNSDAGIYHVRQGSEHSSPSLHSPAIQSSGYENEHLNEAVLAAHSHSHSP----MPMVS 109

Mouse   448 ALRINSGAGP---LKASVPAA-----------LASPSARVSTIGYLNDHDAVTKAIQEARQMKEQ 498
            :..:..|...   :.:::|..           |:.|.|.:...|.....|..:.:..||..|   
  Fly   110 SAYVGGGTASGSLINSNIPLLGGGGNSVLNKFLSHPHAGMVGGGTGQMEDCTSHSPIEAASM--- 171

Mouse   499 LRREQQALDGKVAVVNSIGLSNC-RTEKEKTTLESLTQQLAVKQNEEGKFSHGMMDFNMSGDSDG 562
                 .:.|.|    ..:...|| ..|:.|.                           :..|...
  Fly   172 -----WSYDYK----GDLCAPNCGYLERHKP---------------------------LPADLKY 200

Mouse   563 SAGVSESRIYRESRGRGSNEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNISKILGSRWKAMT 627
            ..|.::|:..:|||        |:|||||||||||.||:|:....||:||:::||:||.:|:::|
  Fly   201 RPGGTQSKSAKESR--------IRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLT 257

Mouse   628 NLEKQPYYEEQARLSKQHLEKYPDYKYKPRPKRTCLVDGKKLRIGEYKAIMRNRRQEMRQYFNVG 692
            ..:::||.||..||...|:.::|:|||:||.::.     .|||     |:....:::.....|.|
  Fly   258 PQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQ-----SKLR-----AMQPGGKEQSESSPNPG 312

Mouse   693 --------QQAQIPIATAGVVYPSAIAMAGMPSPHLPSEHSSVSSSPE-PGMPVIQSTYGAKGEE 748
                    :.|..|:|||...|.:            |::.|:.:|:.: .|    |||.|...|:
  Fly   313 TGGSKSNPKLATPPLATASSSYTT------------PTDESTCNSTNQNHG----QSTPGGLYEQ 361

Mouse   749 PHIKEEIQAEDINGEIYEEYDEEEE 773
            | :|.......:  :.|...|..|:
  Fly   362 P-LKPTYSPSSV--DCYSNADSTEQ 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox5XP_006506994.1 SOX-TCF_HMG-box 584..655 CDD:238684 35/70 (50%)
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 36/78 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.