DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox2 and Sox15

DIOPT Version :9

Sequence 1:NP_035573.3 Gene:Sox2 / 20674 MGIID:98364 Length:319 Species:Mus musculus
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:273 Identity:84/273 - (30%)
Similarity:134/273 - (49%) Gaps:60/273 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse    33 GGNQKNS--PDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDE 95
            ||.|..|  ..|::|||||||||::.:|:|:|.|||.:||:::||.||.:|:.|:..::||:::|
  Fly   203 GGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEE 267

Mouse    96 AKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA-SGVGVGAGLGAGVNQRM 159
            |:|||.:||.|||:|||||||:.::.::         .:.|||...: |....|.| |:..|.::
  Fly   268 AERLRVIHMTEHPNYKYRPRRRKQSKLR---------AMQPGGKEQSESSPNPGTG-GSKSNPKL 322

Mouse   160 DSYAHMNGWSNGSYSMMQEQL---GYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNG 221
            .:.....  ::.||:...::.   ...|:.|.:..|....||:                      
  Fly   323 ATPPLAT--ASSSYTTPTDESTCNSTNQNHGQSTPGGLYEQPL---------------------- 363

Mouse   222 SPTYSMS----YSQQGTPGMALGSMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPG 282
            .||||.|    ||...:.        ..::|.|::.||.:.:.|   :|...|...   |:.|..
  Fly   364 KPTYSPSSVDCYSNADST--------EQIESLAANCPPALLNES---SPTGGGYDN---SLLLKK 414

Mouse   283 AEVPEP--AAPSR 293
            ...|.|  ||.||
  Fly   415 LTKPSPSRAAKSR 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox2NP_035573.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 4/11 (36%)
SOX-TCF_HMG-box 42..113 CDD:238684 38/70 (54%)
SOXp 112..202 CDD:403523 20/93 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..267 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..319
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 38/70 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.