DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox18 and Sox100B

DIOPT Version :9

Sequence 1:NP_033262.2 Gene:Sox18 / 20672 MGIID:103559 Length:377 Species:Mus musculus
Sequence 2:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster


Alignment Length:404 Identity:112/404 - (27%)
Similarity:153/404 - (37%) Gaps:132/404 - (32%)


- Green bases have known domain annotations that are detailed below.


Mouse    79 IRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERLRVQHLRDH 143
            |:||||||||||:..|:.:::|.|.|.|:.|||.|||.||.|..::|:||:|.||:||:.|.::|
  Fly    77 IKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMTHKQEH 141

Mouse   144 PNYKYRPRRKKQARKVRRLE--------PGLLLPGLVQPSAPPEA-------------FAAASGS 187
            |:|||:||||| ||.:...:        |.:.|...:..|..|.:             .||..||
  Fly   142 PDYKY
QPRRKK-ARVLPSQQSGEGGSPGPEMTLSATMGSSGKPRSSNSNGQRRAGKGNAAADLGS 205

Mouse   188 ARSFRELPTLGAEFD----------------------------GLGLPTPERSPLDGLEPGEASF 224
            ..|......:|:...                            ||..|....|.:..|.|...  
  Fly   206 CASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQSLIETGLDSPCSTASSMSSLTPPAT-- 268

Mouse   225 FPPPLAPEDCALRAFRAPYAPELARDPSFC--------------YGAPLAEALRTAPPAAPL--- 272
             |..:||.:....|         |.:||..              ||. |.||.|.......:   
  Fly   269 -PYNVAPSNAKASA---------ANNPSLLLRQLSEPVANAGDGYGV-LLEAGREYVAIGEVNYQ 322

Mouse   273 ---AGL---------------------YYGTLGTPGPFPNPLSP----------PPESPSLEGTE 303
               ||:                     |.|..|:...:|....|          ..:..:|:.:|
  Fly   323 GQSAGVQSGAEGGGAGQEMDFLENINGYGGYTGSRVSYPAYSYPANGGHFATEEQQQQQALQASE 387

Mouse   304 QL--EPTADLWADVDLTEFDQY-----LNCSRTRPDATTLPYHVALAKLGPRAMSCPEESSLISA 361
            .|  :|.|   ||:|..|.|||     |..::......|.|.|..|....|...|    :||.||
  Fly   388 ALNYKPAA---ADIDPKEIDQYFMDQMLPMTQHHHPHHTHPLHHPLHHSPPLNSS----ASLSSA 445

Mouse   362 LSDASS----AVYY 371
            .|.|||    |.||
  Fly   446 CSSASSQQPVAEYY 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox18NP_033262.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76
SOX-TCF_HMG-box 78..149 CDD:238684 38/69 (55%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:26939885 81..94 10/12 (83%)
Interaction with DNA. /evidence=ECO:0000269|PubMed:26939885 105..117 7/11 (64%)
Important for transcriptional activation. /evidence=ECO:0000269|PubMed:10742113, ECO:0000269|PubMed:7651823 160..225 16/113 (14%)
Sox_C_TAD 187..375 CDD:288887 59/275 (21%)
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 37/68 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.