DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox14 and Sox100B

DIOPT Version :9

Sequence 1:NP_035570.1 Gene:Sox14 / 20669 MGIID:98362 Length:240 Species:Mus musculus
Sequence 2:NP_651839.1 Gene:Sox100B / 45039 FlyBaseID:FBgn0024288 Length:529 Species:Drosophila melanogaster


Alignment Length:242 Identity:79/242 - (32%)
Similarity:118/242 - (48%) Gaps:41/242 - (16%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 KPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQ 67
            :..:||||||||||||::..||.|:::.|.:.|||:||.||..||.|.:::|:|:::.|::||..
  Fly    72 RKKEHIKRPMNAFMVWAQAARRVMSKQYPHLQNSELSKSLGKLWKNLKDSDKKPFMEFAEKLRMT 136

Mouse    68 HMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKA-RAFLPP 131
            |.:|||||||:||||...:|                |.:.:|  .|.|.|    ||.. .|.:..
  Fly   137 HKQEHPDYKYQPRRKKARVL----------------PSQQSG--EGGSPG----PEMTLSATMGS 179

Mouse   132 ASAPYSLLDPAQ---FSSSAIQKMGEVPHTLATSALPYASTLGYQNGAF-GSLSCPSQHTHTHPS 192
            :..|.|.....|   ...:|...:|....|::.:.:...|:..:.|.|| .||:.....:....|
  Fly   180 SGKPRSSNSNGQRRAGKGNAAADLGSCASTISHANVGSNSSDVFSNEAFMKSLNSACAASLMEQS 244

Mouse   193 PTNPGYVVPCNCTAWSASTLQPPVAYILFPGMTKTGIDPYSSAHATA 239
            ....|...||: ||.|.|:|.||..             ||:.|.:.|
  Fly   245 LIETGLDSPCS-TASSMSSLTPPAT-------------PYNVAPSNA 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox14NP_035570.1 SOX-TCF_HMG-box 7..78 CDD:238684 38/70 (54%)
SOXp 77..>118 CDD:403523 10/40 (25%)
Sox100BNP_651839.1 SOX-TCF_HMG-box 76..146 CDD:238684 37/69 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.