DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox13 and Sox15

DIOPT Version :9

Sequence 1:XP_011246247.1 Gene:Sox13 / 20668 MGIID:98361 Length:621 Species:Mus musculus
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:422 Identity:109/422 - (25%)
Similarity:167/422 - (39%) Gaps:111/422 - (26%)


- Green bases have known domain annotations that are detailed below.


Mouse   261 EYPLQLL---HSPPAPVVKRSGVAAHHPLQEPPQPLNLTAKPKVPELPNTS------------SS 310
            |:|..||   :|...|.|.|:...:|....:.|:........::....|:.            ||
  Fly     8 EHPHHLLTNYNSKKYPHVSRTPEYSHSTGSDYPEHGGYLTDGRLMHESNSDAGIYHVRQGSEHSS 72

Mouse   311 PSLKMNSCGPRPASHGAPTRDLQS----------SP-PSLPLGFLGEGDAVTKAIQDARQLLHSH 364
            |||.    .|...|.|.....|..          || |.:...::|.|.|       :..|::|:
  Fly    73 PSLH----SPAIQSSGYENEHLNEAVLAAHSHSHSPMPMVSSAYVGGGTA-------SGSLINSN 126

Mouse   365 SGALENSPNTPFRKDLISLDSSP-------AKERLEESCVH-PLEEA-MLSCDMDG--------- 411
            ...|....|:...|.|    |.|       ...::|:...| |:|.| |.|.|..|         
  Fly   127 IPLLGGGGNSVLNKFL----SHPHAGMVGGGTGQMEDCTSHSPIEAASMWSYDYKGDLCAPNCGY 187

Mouse   412 -SRH--------------FSESRNSSHIKRPMNAFMVWAKDERRKILQAFPDMHNSSISKILGSR 461
             .||              .|:|...|.|:|||||||||||.||:|:....||:||:.:||:||.:
  Fly   188 LERHKPLPADLKYRPGGTQSKSAKESRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKK 252

Mouse   462 WKSMTNQEKQPYYEEQARLSRQHLEKYPDYKYKPRPKRTCVVEGRRLRVGEYKALMRTRRQGARQ 526
            |:|:|.|:::||.||..||...|:.::|:|||:||.::              ::.:|..:.|.::
  Fly   253 WRSLTPQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRK--------------QSKLRAMQPGGKE 303

Mouse   527 SYTIPPQAGQAQVSSDILFPRAAGLPLARPLVEHYDPQGLDPNMPVIINTCSLREEGEGTDDRHS 591
            .....|..|.....|:   |:.|..|||.....:        ..|...:||:...:..|..    
  Fly   304 QSESSPNPGTGGSKSN---PKLATPPLATASSSY--------TTPTDESTCNSTNQNHGQS---- 353

Mouse   592 VADGEMYR------YSEDE-DSEGDEKSDEEL 616
             ..|.:|.      ||... |...:..|.|::
  Fly   354 -TPGGLYEQPLKPTYSPSSVDCYSNADSTEQI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox13XP_011246247.1 Atrophin-1 <231..>340 CDD:367360 23/104 (22%)
SOX-TCF_HMG-box 423..494 CDD:238684 37/70 (53%)
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 37/70 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.