DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox12 and Sox15

DIOPT Version :9

Sequence 1:NP_035568.1 Gene:Sox12 / 20667 MGIID:98360 Length:314 Species:Mus musculus
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:296 Identity:80/296 - (27%)
Similarity:129/296 - (43%) Gaps:83/296 - (28%)


- Green bases have known domain annotations that are detailed below.


Mouse    18 PGPGPAAEGAREPGWCKTPSGHIKRPMNAFMVWSQHERRKIMDQWPDMHNAEISKRLGRRWQLLQ 82
            || |..::.|:|        ..|:|||||||||::.||:|:.|:.||:|||::||.||::|:.|.
  Fly   202 PG-GTQSKSAKE--------SRIRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLT 257

Mouse    83 DSEKIPFVREAERLRLKHMADYPDYKYRPRKKSKGAPAKARPRPPGG----------GGGGSRLK 137
            ..::.|:|.||||||:.||.::|:||||||::.:   :|.|...|||          |.|||:..
  Fly   258 PQDRRPYVEEAERLRVIHMTEHPNYKYRPRRRKQ---SKLRAMQPGGKEQSESSPNPGTGGSKSN 319

Mouse   138 PGPQLPGRGGRRASGGPLGGGAAA---PEDDDEDEEEELLEVRLLETPGRELWRMVPAGRAARGP 199
            |....|          ||...:::   |.|:.           ...:..:...:..|.|...: |
  Fly   320 PKLATP----------PLATASSSYTTPTDES-----------TCNSTNQNHGQSTPGGLYEQ-P 362

Mouse   200 AERAQGPSGEGAAASAAS------------PTLSEDEEP-----------------------EEE 229
            .:....||.....::|.|            |.|..:..|                       :..
  Fly   363 LKPTYSPSSVDCYSNADSTEQIESLAANCPPALLNESSPTGGGYDNSLLLKKLTKPSPSRAAKSR 427

Mouse   230 EEEAATAEEGEEETVVSGEEPLG-FLSRMPPGPAGL 264
            :|:.|.:||..:.:...|:...| :.:..|..|..:
  Fly   428 QEKLAKSEEKNKGSQSQGQSQQGIYAATYPLAPTSV 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox12NP_035568.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 5/21 (24%)
SOX-TCF_HMG-box 39..110 CDD:238684 38/70 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..287 41/213 (19%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000269|PubMed:18403418 282..314
Sox15NP_523739.2 SOX-TCF_HMG-box 214..285 CDD:238684 38/70 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838614
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0527
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000028
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10270
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R685
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.