DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sox11 and Sox15

DIOPT Version :10

Sequence 1:NP_033260.4 Gene:Sox11 / 20666 MGIID:98359 Length:395 Species:Mus musculus
Sequence 2:NP_523739.2 Gene:Sox15 / 36575 FlyBaseID:FBgn0005613 Length:784 Species:Drosophila melanogaster


Alignment Length:275 Identity:84/275 - (30%)
Similarity:123/275 - (44%) Gaps:63/275 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    49 IKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADY 113
            |:|||||||||:||||:|:.:::||:|||::||.|||:|:.|...::.|::.||||||:.||.::
  Fly   215 IRRPMNAFMVWAKIERKKLADENPDLHNADLSKMLGKKWRSLTPQDRRPYVEEAERLRVIHMTEH 279

Mouse   114 PDYKYRPRKKPKT-----DPAAKPSAGQSPDKSAAGAKAAKGPGKKCAKLKAPAGKAGAGKAAQP 173
            |:||||||::.::     .|..|..:..||:....|:|:  .|     ||..|.....:.....|
  Fly   280 PNYKYRPRRRKQSKLRAMQPGGKEQSESSPNPGTGGSKS--NP-----KLATPPLATASSSYTTP 337

Mouse   174 GDCAAGKAAKCVFLDDDDEDDDEDDELQLRPKPDADDDDDEPAHSHLLPPPTQQQPPQLLRRYSV 238
            .|                               ::..:.....|....|....:||  |...|| 
  Fly   338 TD-------------------------------ESTCNSTNQNHGQSTPGGLYEQP--LKPTYS- 368

Mouse   239 AKVPASPTLSSAAESPE----------GASLYDEVRAGGRLYYS--FKNITKQQPPPAPPALSPA 291
               |:|....|.|:|.|          .|.|.:....||....|  .|.:||  |.|:..|.|..
  Fly   369 ---PSSVDCYSNADSTEQIESLAANCPPALLNESSPTGGGYDNSLLLKKLTK--PSPSRAAKSRQ 428

Mouse   292 SSRCVSTSSSSGSSS 306
            .....|...:.||.|
  Fly   429 EKLAKSEEKNKGSQS 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sox11NP_033260.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
HMG-box_SoxC_SOX11 38..129 CDD:438846 43/84 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..258 32/158 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..312 10/31 (32%)
Required for transcriptional activation activity and synergistic coactivation of transcriptional activity with POU3F2. /evidence=ECO:0000269|PubMed:18403418 363..395
Sox15NP_523739.2 HMG-box_SoxF 214..289 CDD:438841 43/73 (59%)
PHA03273 305..>391 CDD:223031 23/129 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.