DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NR2F6 and usp

DIOPT Version :9

Sequence 1:NP_005225.2 Gene:NR2F6 / 2063 HGNCID:7977 Length:404 Species:Homo sapiens
Sequence 2:NP_001259168.1 Gene:usp / 31165 FlyBaseID:FBgn0003964 Length:508 Species:Drosophila melanogaster


Alignment Length:460 Identity:152/460 - (33%)
Similarity:212/460 - (46%) Gaps:82/460 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAE--PGDEERPGLQVDCVVCGDKS 63
            |:||....|.....:|. :.||....|...:||....||:..:  |.:....|.:..|.:|||::
  Fly    48 MSMVHVLPGSNSASSNN-NSAGDAQMAQAPNSAGGSAAAAVQQQYPPNHPLSGSKHLCSICGDRA 111

Human    64 SGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQ- 127
            |||||||::|||||.||||::|::|:|.||.||:|.||:..||:|||||.:||...||::|||| 
  Fly   112 SGKHYGVYSCEGCKGFFKRTVRKDLTYACRENRNCIIDKRQRNRCQYCRYQKCLTCGMKREAVQE 176

Human   128 -RGRIPHSLPGAVAASSG--SPPGSALAAVASGG----------------DLFPGQPVS-----E 168
             |.|...:..|.::||.|  |.|||...:.:.||                |.|....||     |
  Fly   177 ERQRGARNAAGRLSASGGGSSGPGSVGGSSSQGGGGGGGVSGGMGSGNGSDDFMTNSVSRDFSIE 241

Human   169 LIAQ---------------LLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWAR 218
            .|.:               .||..||......:   .||..|      :|::..:.||..||:||
  Fly   242 RIIEAEQRAETQCGDRALTFLRVGPYSTVQPDY---KGAVSA------LCQVVNKQLFQMVEYAR 297

Human   219 HAPFFPELPVADQVALLRLSWSELFVLNAAQAALPL--------------------HTAPLLAAA 263
            ..|.|.::|:.|||.||:.:|.||.:.|.|..::..                    ..:|.|...
  Fly   298 MMPHFAQVPLDDQVILLKAAWIELLIANVAWCSIVSLDDGGAGGGGGGLGHDGSFERRSPGLQPQ 362

Human   264 GL--------HAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSD 320
            .|        |..........|..|  |...|...|:.||.:|..|..|||||.|:.||..|:..
  Fly   363 QLFLNQSFSYHRNSAIKAGVSAIFD--RILSELSVKMKRLNLDRRELSCLKAIILYNPDIRGIKS 425

Human   321 PAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETL 385
            .|.:|..:||....|.|:.|.::|....||.:|||||||||::.......||..|:....|:|.|
  Fly   426 RAEIEMCREKVYACLDEHCRLEHPGDDGRFAQLLLRLPALRSISLKCQDHLFLFRITSDRPLEEL 490

Human   386 IRDML 390
            ..:.|
  Fly   491 FLEQL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NR2F6NP_005225.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 13/49 (27%)
NR_DBD_COUP_TF 56..128 CDD:143516 45/73 (62%)
NR_LBD_COUP-TF 165..400 CDD:132746 79/274 (29%)
Important for dimerization. /evidence=ECO:0000250 327..404 24/64 (38%)
uspNP_001259168.1 NR_DBD_RXR 102..178 CDD:143514 45/75 (60%)
NR_LBD_RXR_like 237..480 CDD:132741 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X118
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.