DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Plk2 and SAK

DIOPT Version :9

Sequence 1:NP_690017.2 Gene:Plk2 / 20620 MGIID:1099790 Length:682 Species:Mus musculus
Sequence 2:NP_649324.1 Gene:SAK / 40384 FlyBaseID:FBgn0026371 Length:769 Species:Drosophila melanogaster


Alignment Length:580 Identity:153/580 - (26%)
Similarity:246/580 - (42%) Gaps:159/580 - (27%)


- Green bases have known domain annotations that are detailed below.


Mouse    84 VLGKGGFAKCYEMTDLTNNKVYAAKIIPHSRVAKPHQREKIDKEIELHRLLHHKHVVQFYHYFED 148
            :|||||||..|:...|..::..|.|:|....:.......::.:|:|:|..|.|..|:|.|.:|:|
  Fly    19 LLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQD 83

Mouse   149 KENIYILLEYCS----RRSMAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKLGNFF 209
            ...:|::||...    .|.|.||.:.   .||.|....|:|:|:||.|||...|:|||:.|.|..
  Fly    84 ANYVYLVLELAHNGELHRYMNHIARP---FTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLL 145

Mouse   210 INEAMELKVGDFGLAARLEPLEHRRRTICGTPNYLSPEVLNKQGHGCESDIWALGCVMYTMLLGR 274
            ::..|.:|:.|||||.:|:..:.|..|:||||||:||||:::..||..:|:|::||::||:|:||
  Fly   146 LSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGR 210

Mouse   275 PPFETTNLKETYRCIREARYTMPSSLLAPAKHLIASMLSKNPEDRPSLDDIIRHDFFLQGFTPDR 339
            |||||..::.|...:..:.|.||:.|...|:.||..:|.|.|.:|.:|:.::.|.|.|:      
  Fly   211 PPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVLCHPFMLK------ 269

Mouse   340 LSSSCCHTVPDFHLSSPAKNFFKKAAAALFGG--------KKDKARYNDTHNKVSKEDEDIYKLR 396
             .|:..|:.|.      |.|.|.::..:...|        .::..:.....|  |...:.:.::|
  Fly   270 -CSNGGHSAPG------ALNVFSQSMESGDSGIITFASSDSRNSQQIRSVEN--SGPQQVLPQIR 325

Mouse   397 HDLKKV-----------------------------------SITQQPSKHRA----DEEPQPP-- 420
            .:.|:|                                   .....|:..:|    |....||  
  Fly   326 EEFKQVHHKLPYEQTGLFGQASTGLAEPNWPGAAKSSAFCMEAGNVPNSKQASLKEDRISVPPLN 390

Mouse   421 -----PT---------TVARSGTSAVE--------NKQQIGDAIRMIVRGTLGSCSSSSECLEDS 463
                 ||         ::.|:|...:|        |:.:|.|..|                    
  Fly   391 TKRLLPTRYKTKNAIMSILRNGEVVLEFLKFRPTYNEDRINDICR-------------------- 435

Mouse   464 TMGSVADTVARVL-------RGC--------LENMPEADCIPKEQLSTSFQWVTKWVDYSNKYGF 513
                ::|...|::       ||.        |: :|..||:.......|..|        .||.:
  Fly   436 ----ISDDGQRIIIYQPDPGRGLPVREQPPDLQ-IPSGDCVYNYDNLPSKHW--------KKYIY 487

Mouse   514 GYQLSDHTVGVLFNNGAHMSLLPDKKT--VHYYAELGQCSVFPA-TDAPEQFISQVTVLK 570
            |.:.    ||           |...||  |.|::.||:|.:... ||...:|.|...:||
  Fly   488 GARF----VG-----------LVKSKTPKVTYFSTLGKCQLMETMTDFEIRFYSGAKLLK 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Plk2NP_690017.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..67
STKc_PLK2 77..331 CDD:271090 96/250 (38%)
S_TKc 79..331 CDD:214567 96/250 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 403..432 9/48 (19%)
POLO_box_1 500..585 CDD:240561 20/74 (27%)
POLO_box_2 598..679 CDD:240560
SAKNP_649324.1 STKc_PLK4 12..267 CDD:271088 96/250 (38%)
S_TKc 14..267 CDD:214567 96/250 (38%)
POLO_box_Plk4_1 382..497 CDD:240557 28/162 (17%)
POLO_box_Plk4_2 498..596 CDD:240558 13/35 (37%)
POLO_box_Plk4_3 657..738 CDD:240559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0575
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D507604at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.