DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Snai1 and wor

DIOPT Version :9

Sequence 1:	NP_035557.1	Gene:	Snai1 / 20613	MGIID:	98330	Length:	264	Species:	Mus musculus
Sequence 2:	NP_476601.1	Gene:	wor / 34906	FlyBaseID:	FBgn0001983	Length:	548	Species:	Drosophila melanogaster

Alignment Length:	144	Identity:	94/144 - (65%)
Similarity:	112/144 - (77%)	Gaps:	6/144 - (4%)

- Green bases have known domain annotations that are detailed below.

Mouse   124 EAFIAFPGLGQLPKQLARLSVAKDPQSRKIFNCKYCNKEYLSLGALKMHIRSHTLPCVCTTCGKA 188
            :::..:.||.:  .|......|:..|.:|:|:||.|:|.|:||||||||||:|||||.|..||||
  Fly   352 KSYSTYSGLSK--HQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHTLPCKCPICGKA 414

Mouse   189 FSRPWLLQGHVRTHTGEKPFSCSHCNRAFADRSNLRAHLQTHSDVKRYQCQACARTFSRMSLLHK 253
            ||||||||||:|||||||||||.|||||||||||||||:|||||||:|.|..|.::|||||||.|
  Fly   415 FSRPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAK 479

Mouse   254 HQESGC----SGGP 263
            |.:|||    ||||
  Fly   480 HLQSGCQTEQSGGP 493

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Snai1	NP_035557.1	SNAG domain. /evidence=ECO:0000305	1..20
		Required and sufficient for interaction with KDM1A. /evidence=ECO:0000250\|UniProtKB:O95863	2..7
		LATS2 binding. /evidence=ECO:0000250	10..40
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	85..116
		Destruction motif	95..100
		Required for FBXL14-triggered degradation. /evidence=ECO:0000250	120..151		5/26 (19%)
		Required for nuclear localization and interaction with KPNB1, NOTCH1 and PARP1. /evidence=ECO:0000250	151..264		89/117 (76%)
		C2H2 Zn finger	156..176	CDD:275368	15/19 (79%)
		COG5048	<177..>253	CDD:227381	62/75 (83%)
		C2H2 Zn finger	182..202	CDD:275368	16/19 (84%)
		zf-H2C2_2	195..218	CDD:290200	20/22 (91%)
		zf-C2H2	208..230	CDD:278523	19/21 (90%)
		C2H2 Zn finger	210..230	CDD:275368	17/19 (89%)
		C2H2 Zn finger	238..255	CDD:275368	10/16 (63%)
wor	NP_476601.1	C2H2 Zn finger	270..290	CDD:275368
		C2H2 Zn finger	317..334	CDD:275368
		zf-C2H2	345..367	CDD:278523	3/16 (19%)
		C2H2 Zn finger	347..367	CDD:275368	3/16 (19%)
		PHA00732	379..>417	CDD:177300	27/37 (73%)
		C2H2 Zn finger	382..402	CDD:275368	15/19 (79%)
		zf-C2H2_8	405..482	CDD:292531	62/76 (82%)
		zf-C2H2	406..428	CDD:278523	17/21 (81%)
		C2H2 Zn finger	408..428	CDD:275368	16/19 (84%)
		zf-H2C2_2	421..444	CDD:290200	20/22 (91%)
		zf-C2H2	434..456	CDD:278523	19/21 (90%)
		C2H2 Zn finger	436..456	CDD:275368	17/19 (89%)
		zf-H2C2_2	448..473	CDD:290200	16/24 (67%)
		C2H2 Zn finger	464..481	CDD:275368	10/16 (63%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	52	1.000	Domainoid score	I11386
eggNOG	1	0.900	-	-		E1_KOG2462
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0012001
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X955
SwiftOrtho	1	1.000	-	-
TreeFam	1	0.960	-	-
	8	7.770