DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment USF3 and CBF1

DIOPT Version :9

Sequence 1:	NP_001009899.3	Gene:	USF3 / 205717	HGNCID:	30494	Length:	2245	Species:	Homo sapiens
Sequence 2:	NP_012594.1	Gene:	CBF1 / 853523	SGDID:	S000003821	Length:	351	Species:	Saccharomyces cerevisiae

Alignment Length:	125	Identity:	37/125 - (29%)
Similarity:	64/125 - (51%)	Gaps:	13/125 - (10%)

- Green bases have known domain annotations that are detailed below.

Human    11 TKKQHRKKNRETHNAVERHRKKKINAGINRIGELIPCSPALKQSKNMILDQAFKYITELKRQND- 74
            |..:.:|:.:::|..|||.|::.||..||.:.:|:   |..:.||..||..|.:||.:||..::
Yeast   215 TTDEWKKQRKDSHKEVERRRRENINTAINVLSDLL---PVRESSKAAILACAAEYIQKLKETDEA 276

Human    75 -------ELLLNGGNNEQ-AEEIKKLRKQLEEIQKENGRYIELLKANDICLYDDPTIHWK 126
                   :.||:..|..| |...:||:::|....||. .|::.:...:...|:|...|.|
Yeast   277 NIEKWTLQKLLSEQNASQLASANEKLQEELGNAYKEI-EYMKRVLRKEGIEYEDMHTHKK 335

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
USF3	NP_001009899.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..28		4/16 (25%)
		bHLHzip_USF3	15..79	CDD:381480	22/71 (31%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	271..290
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	447..470
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	881..900
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	906..933
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1015..1041
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1164..1238
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1307..1331
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1460..1624
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1636..1664
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1736..1764
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1777..1815
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1834..1859
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1891..2031
CBF1	NP_012594.1	HLH	220..272	CDD:238036	20/54 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910