DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment USF3 and Hey

DIOPT Version :9

Sequence 1:NP_001009899.3 Gene:USF3 / 205717 HGNCID:30494 Length:2245 Species:Homo sapiens
Sequence 2:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster


Alignment Length:433 Identity:101/433 - (23%)
Similarity:152/433 - (35%) Gaps:112/433 - (25%)


- Green bases have known domain annotations that are detailed below.


Human  1175 PFKSQIPKESGTGQAEATPNEFNSQGSIE--ATMERPLEKPSCSLGIKTSNASLQDSTSQPPSIT 1237
            |....:|.......|.:..:..:|||...  .:::|.|.:..|.......::..|.|.|:|.|..
  Fly    33 PQSHWVPPPQSHHSAHSNHSHGHSQGHSHGIGSLKRTLSESDCDDLYSEESSKEQISPSEPGSCQ 97

Human  1238 SLS------VNNLIHQSSISHPLASCAGLSPTSE--------------QTTVPATVNL---TVSS 1279
            .:|      |.....:..|:..|.....|.|::.              |.||....:|   |:.|
  Fly    98 LMSRKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQSKTLDS 162

Human  1280 SSYGSQPPGPSLMTEY-------SQEQLNTMTSTIPNSQIQEPL-------LKPSHESRKDSAKR 1330
            .||..|    .:..:|       ...::.....||....||:||       |:...:.|:.|||.
  Fly   163 LSYDPQ----RVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQQRELSAKS 223

Human  1331 AVQ----DDLLLSSAKRQKHCQPAPLRLESMSLMSRTPDTISDQTQMMVSQIPPNSSNSVVPVSN 1391
            ...    .....||:..|.:|..||.                   |...:...|.:..|..|..:
  Fly   224 CASPGGWSPAAPSSSGYQPNCAAAPY-------------------QSYAAPANPGAYVSSYPTLS 269

Human  1392 PAHGDGLTRLFPPSNNFVTPALRQTEVQCGSQPSVAEQQQTQASQHLQALQQHVPAQGVSHLHSN 1456
            .:          ||         |...|.|.:.||:   :|..|...::|..|       .|||:
  Fly   270 AS----------PS---------QQAQQLGGRTSVS---RTSGSAVTESLPSH-------DLHSD 305

Human  1457 HLYIKQQQQQQQQQQQQQQQQQAGQLRERH-----HLYQMQHHVPHAESSVHSQPHNVHQQRTLQ 1516
            ....:|||||||||||||.|||..|.:::.     ...|.||:. |..|:|||:     ||....
  Fly   306 SSSQQQQQQQQQQQQQQQHQQQQHQQQQQRTQTTPQPTQQQHYT-HDHSAVHSE-----QQVPTY 364

Human  1517 QEVQMQKKRNLVQGTQTSQLSLQPKH-----HGTDQSRSKTGQ 1554
            .|: ....|....|:.:...|..|::     .|.|.:.|...|
  Fly   365 IEL-TNSNRPAAIGSDSLSYSAAPQYPVSGLPGQDYNNSSVLQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
USF3NP_001009899.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
bHLHzip_USF3 15..79 CDD:381480
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..290
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 447..470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 881..900
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 906..933
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1041
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1164..1238 14/64 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1307..1331 10/30 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1460..1624 36/105 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1636..1664
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1736..1764
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1777..1815
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1834..1859
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1891..2031
HeyNP_523657.1 HLH 100..156 CDD:238036 9/55 (16%)
ORANGE 172..218 CDD:128787 8/45 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.