DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc25a14 and CG1907

DIOPT Version :9

Sequence 1:NP_001277634.1 Gene:Slc25a14 / 20523 MGIID:1330823 Length:344 Species:Mus musculus
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:312 Identity:102/312 - (32%)
Similarity:166/312 - (53%) Gaps:19/312 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse    38 SSAELEQHQKSSTLSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIK 102
            |:..:::..|.:..::.:.      |::|||:.:.|.....|:||.|||:|:.|.....:    :
  Fly     2 SATSVQEAPKKAVATNAIK------FLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKK----E 56

Mouse   103 YRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIKIGIYQSLKRLFVERLE-DETLLINMIC 166
            ||...|.:..|..:||.||||.||..||||||:|.|.::|:|..|..||.|:.: ...:..:|..
  Fly    57 YRSSLHCIQTIVSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAM 121

Mouse   167 GVVSGVISSTIANPTDVLKIRMQAQGSL------FQGSMIGSFIDIYQQEGTRGLWRGVVPTAQR 225
            |.::|...:.|..|.:|..:||.:.|.|      ...::..:...|.::||...||||.:||..|
  Fly   122 GTIAGACGAFIGTPAEVALVRMTSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGR 186

Mouse   226 AAIVVGVELPVYDITKKHLIVSGM-LGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRAIV 289
            |.:|...:|..|...|.:.....: :.:.|..||.:|...||...:.|.|:|:.:||:.|.:.:.
  Fly   187 AMVVNMTQLASYSQFKTYFRHGPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVD 251

Mouse   290 GHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKR 341
            |..: |:||.|.:|::.:.||.|||:|||.|.:.||||..::.||..|||.:
  Fly   252 GKPE-YRGTADVLLRVARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc25a14NP_001277634.1 PTZ00169 63..342 CDD:240302 100/287 (35%)
Mito_carr 253..342 CDD:365909 36/89 (40%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 39/102 (38%)
Mito_carr 118..207 CDD:278578 25/88 (28%)
Mito_carr 219..307 CDD:278578 35/85 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54059
OrthoDB 1 1.010 - - D892773at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.