DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc25a14 and CG8323

DIOPT Version :9

Sequence 1:NP_001277634.1 Gene:Slc25a14 / 20523 MGIID:1330823 Length:344 Species:Mus musculus
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:289 Identity:92/289 - (31%)
Similarity:160/289 - (55%) Gaps:13/289 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse    63 FVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDVRFKEIK-YRGMFHALFRIYKEEGILALYSGI 126
            ||.|||||:.|.|.|.|:::.|||:|:||: :..|...:: |:|:.:|...:.|.:||..|..|:
  Fly     6 FVLGGLASVGATFFTNPIEVIKTRIQLQGE-LAARGTYVEPYKGIVNAFITVAKNDGITGLQKGL 69

Mouse   127 APALLRQASYGTIKIGIY-QSLKRLFVERLEDETLL-INMICGVVSGVISSTIANPTDVLKIRMQ 189
            ||||..|....:.::.|| ::::|.::...:.|... :.::.|.:.||:....::|..::|.::|
  Fly    70 APALYFQFIINSFRLSIYSEAMERRWMHNRKGEVSYGMGLLWGAIGGVVGCYFSSPFFLIKTQLQ 134

Mouse   190 AQGSL-----FQ---GSMIGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIV 246
            :|.:.     :|   .||..:...||.:.|.||||||.|....|||:..|.::..:..||..|:.
  Fly   135 SQAAKQIAVGYQHAHTSMTDALRQIYSRNGVRGLWRGSVAALPRAALGSGAQIATFGKTKALLVQ 199

Mouse   247 SGMLGDTILTHFVSSFTCGLAGALASNPVDVVRTRMMNQRA-IVGHVDLYKGTLDGILKMWKHEG 310
            ..::....|..|.:....|...::|..|.||:.||:.||.. ..|...||:|.||..:|:.:.||
  Fly   200 YDLVTQPTLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGLLYRGWLDCFVKILRSEG 264

Mouse   311 FFALYKGFWPNWLRLGPWNIIFFITYEQL 339
            .:.:|||||.|:||:.|.:.:..:.:::|
  Fly   265 VYGMYKGFWANYLRIAPHSTLVLLFFDEL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc25a14NP_001277634.1 PTZ00169 63..342 CDD:240302 92/289 (32%)
Mito_carr 253..342 CDD:365909 30/88 (34%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 31/81 (38%)
PTZ00169 5..293 CDD:240302 91/287 (32%)
Mito_carr 101..200 CDD:278578 28/98 (29%)
Mito_carr 206..301 CDD:278578 30/88 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.