DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Slc25a14 and Ucp4A

DIOPT Version :9

Sequence 1:NP_001277634.1 Gene:Slc25a14 / 20523 MGIID:1330823 Length:344 Species:Mus musculus
Sequence 2:NP_001188664.1 Gene:Ucp4A / 32764 FlyBaseID:FBgn0030872 Length:340 Species:Drosophila melanogaster


Alignment Length:342 Identity:112/342 - (32%)
Similarity:191/342 - (55%) Gaps:45/342 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    29 PTVVASASQSSAELEQHQKSSTLSHEMSGLNWK-------PFVYGGLASIVAEFGTFPVDLTKTR 86
            |.|.:|.|.:.|       .|:..|::..:.:.       .::...:|:.:||..|:|:||||||
  Fly    10 PAVASSTSSNPA-------PSSGRHQLRPVKFDYADSFACTYIVSVVAASIAELATYPLDLTKTR 67

Mouse    87 LQVQGQSI--DVRFKEIKYRGMFHALFRIYKEEGILALYSGIAPALLRQASYGTIKIGIYQSLKR 149
            ||:||:..  ......::||||....|.|.:|||.|.|:.|:.|||.|...|..::|..|..:::
  Fly    68 LQIQGEGAAHSAGKSNMQYRGMVATAFGIAREEGALKLWQGVTPALYRHVVYSGVRICSYDLMRK 132

Mouse   150 LFVERLEDETLLI--NMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSMIG----------S 202
            .|.:. ..:.|.:  :.:|||.:|.::..:|:|.|::|:::|.:|   :..::|          :
  Fly   133 EFTQN-GTQALPVWKSALCGVTAGAVAQWLASPADLVKVQIQMEG---RRRLMGEPPRVHSAGHA 193

Mouse   203 FIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGM-LGDTILTHFVSSFTCGL 266
            |..|.|:.|.:|||:|.:|..||||:|...:|..|| |.||||::.: :.|....|.::|...|.
  Fly   194 FRQIVQRGGIKGLWKGSIPNVQRAALVNLGDLTTYD-TIKHLIMNRLQMPDCHTVHVLASVCAGF 257

Mouse   267 AGALASNPVDVVRTRMMNQ------RAIVGHVDLYKGTLDGILKMWKHEGFFALYKGFWPNWLRL 325
            ..|:...|.|||:||:|||      |.:     ||:|::|.:.:....|||.||||||.|.|:|:
  Fly   258 VAAIMGTPADVVKTRIMNQPTDENGRGL-----LYRGSVDCLRQTVSKEGFVALYKGFLPCWIRM 317

Mouse   326 GPWNIIFFITYEQLKRL 342
            .||::.|::::||::::
  Fly   318 APWSLTFWLSFEQIRKM 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Slc25a14NP_001277634.1 PTZ00169 63..342 CDD:240302 105/299 (35%)
Mito_carr 253..342 CDD:365909 35/94 (37%)
Ucp4ANP_001188664.1 PTZ00169 39..335 CDD:240302 105/306 (34%)
Mito_carr 39..138 CDD:278578 35/99 (35%)
Mito_carr 142..239 CDD:278578 34/100 (34%)
Mito_carr 248..336 CDD:278578 35/92 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477054at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.