DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EPHB1 and BCK1

DIOPT Version :9

Sequence 1:NP_004432.1 Gene:EPHB1 / 2047 HGNCID:3392 Length:984 Species:Homo sapiens
Sequence 2:NP_012440.1 Gene:BCK1 / 853350 SGDID:S000003631 Length:1478 Species:Saccharomyces cerevisiae


Alignment Length:283 Identity:83/283 - (29%)
Similarity:137/283 - (48%) Gaps:39/283 - (13%)


- Green bases have known domain annotations that are detailed below.


Human   623 EVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFL-------SEASIMGQFDHPNI 680
            |:||.|.||.||   |.|.......:|:|.::......|....|       ||.|.:...||.||
Yeast  1179 EMIGKGSFGAVY---LCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNI 1240

Human   681 IRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDL 745
            ::..|...|:....:..|::..|::.|.:|.. |:|....:..:...:..|:.||.....:|||:
Yeast  1241 VQYLGFENKNNIYSLFLEYVAGGSVGSLIRMY-GRFDEPLIKHLTTQVLKGLAYLHSKGILHRDM 1304

Human   746 AARNILVNSNLVCKVSDFGLSRYLQD--DTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSAS-DV 807
            .|.|:|::.:.:||:||||:||..:|  ..||.|...:      |.|.|||.:..::..||. |:
Yeast  1305 KADNLLLDQDGICKISDFGISRKSKDIYSNSDMTMRGT------VFWMAPEMVDTKQGYSAKVDI 1363

Human   808 WSYGIVMWEVMSFGERPYWDMSNQDVINA---IEQDYRLPP-PMDCPAALHQL---MLD-CWQKD 864
            ||.|.::.|:.: |:||:   ||.:|:.|   |.:....|| |.|....:.|:   .|| |::.:
Yeast  1364 WSLGCIVLEMFA-GKRPW---SNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEIN 1424

Human   865 RNSRPRFAEIVNTLDKMIRNPAS 887
            ...||       |.::::.:|.|
Yeast  1425 PEKRP-------TANELLSHPFS 1440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EPHB1NP_004432.1 EphR_LBD_B1 20..195 CDD:198444
FN3 323..429 CDD:238020
fn3 435..518 CDD:278470
EphA2_TM 546..614 CDD:291255
PTKc_EphR_B 614..882 CDD:173638 81/276 (29%)
Pkinase_Tyr 619..878 CDD:285015 80/272 (29%)
SAM_EPH-B1 908..975 CDD:188950
SAM 908..973 CDD:197735
PDZ-binding. /evidence=ECO:0000255 982..984
BCK1NP_012440.1 STKc_Bck1_like 1173..1440 CDD:270799 82/281 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.