DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sin3b and hfp

DIOPT Version :9

Sequence 1:XP_006530852.1 Gene:Sin3b / 20467 MGIID:107158 Length:1119 Species:Mus musculus
Sequence 2:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster


Alignment Length:162 Identity:35/162 - (21%)
Similarity:64/162 - (39%) Gaps:34/162 - (20%)


- Green bases have known domain annotations that are detailed below.


Mouse   477 VLETNLATIRVLESVQKKLSRMAPEDQEKLRLDDCLGGTSEVIQRRAIHRIYGDKAPEVIESLKR 541
            |...||:     |:::|...:...|.|:|| :|:   |..:.:|::....|.|..|.:::.....
  Fly   476 VTAANLS-----ENIKKAHEKQQEELQKKL-MDE---GDVQTLQQQENMSIKGQSARQLVMQRLM 531

Mouse   542 NPATAVPVVLKRLKAKE-------EEWREAQQGFNKIWREQY--EKAYLKSLDHQA-------VN 590
            .|..:..::|:.:...|       ||.:|....|..:.|...  ||......|.:|       |.
  Fly   532 RPVDSRVIILRNMVGPEDVDETLQEEIQEECSKFGTVSRVIIFNEKQTENEDDDEAEIIVKIFVE 596

Mouse   591 FKQNDTKALRSKSLLN--------EIESVYDE 614
            |... .:|:|.|..|:        .:..:||:
  Fly   597 FSAG-AEAMRGKEALDGRFFGGRRVVAELYDQ 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sin3bXP_006530852.1 Sin3 40..1030 CDD:227889 35/162 (22%)
hfpNP_525123.2 half-pint 10..637 CDD:130706 35/162 (22%)
RRM1_PUF60 130..205 CDD:240816
RRM2_PUF60 227..303 CDD:240817
RRM3_UHM_PUF60 536..636 CDD:241092 19/93 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 1.056642 Normalized mean entropy S2096
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.