Sequence 1: | NP_038693.1 | Gene: | Shox2 / 20429 | MGIID: | 1201673 | Length: | 331 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014693.1 | Gene: | ey / 43812 | FlyBaseID: | FBgn0005558 | Length: | 898 | Species: | Drosophila melanogaster |
Alignment Length: | 418 | Identity: | 89/418 - (21%) |
---|---|---|---|
Similarity: | 134/418 - (32%) | Gaps: | 218/418 - (52%) |
- Green bases have known domain annotations that are detailed below.
Mouse 80 GGGAGGGAGGGRSPVRELDMGAAERSREPGSPRLTEVSPELKDRKDDAKGMEDEGQTKIKQR--R 142
Mouse 143 SRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQE-------- 199
Mouse 200 -----------------------NQLH--KGVLIGAAS--------------------------- 212
Mouse 213 --------------------------QFEACR--------------------------------- 218
Mouse 219 VAPYVNVG--------------ALRMPFQQDSHCNVTPL-SFQ--------------VQAQLQLD 254
Mouse 255 S-----------AVAHAHHHLHP-----------------HLAAH---APYMMFPAPPFGLPLAT 288
Mouse 289 LAADSASAASVVAAAAAAKTTSKNSSIA 316 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Shox2 | NP_038693.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 26..140 | 9/59 (15%) | |||
Homeobox | 143..197 | CDD:395001 | 31/53 (58%) | ||
OAR | 311..327 | CDD:397759 | 2/6 (33%) | ||
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 | 313..326 | 2/4 (50%) | |||
ey | NP_001014693.1 | PAX | 98..221 | CDD:128645 | |
Homeobox | 475..527 | CDD:278475 | 31/51 (61%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000011 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6207 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |