DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srsf5 and x16

DIOPT Version :9

Sequence 1:NP_001334344.1 Gene:Srsf5 / 20384 MGIID:98287 Length:270 Species:Mus musculus
Sequence 2:NP_723226.1 Gene:x16 / 33967 FlyBaseID:FBgn0028554 Length:258 Species:Drosophila melanogaster


Alignment Length:318 Identity:89/318 - (27%)
Similarity:115/318 - (36%) Gaps:137/318 - (43%)


- Green bases have known domain annotations that are detailed below.


Mouse     5 RVFIGRLNPAAREKDVERFFKGYGRIRDIDLKR---GFGFVEFEDPRDADDAVYELDGKELCSER 66
            :|::|.|...||:.|:|..|..||.:|.:.:.|   ||.|||||..|||.|||..|||:.:|..|
  Fly     9 KVYVGDLGNNARKNDLEYVFGAYGSLRSVWIARNPPGFAFVEFESARDAADAVRGLDGRTVCGRR 73

Mouse    67 VTIE-----HARA------------------RSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTEN 108
            ..:|     :||:                  |.|||.|||                         
  Fly    74 ARVELSTGKYARSGGGGGGGGGGGGGGGLGGRDRGGGGRG------------------------- 113

Mouse   109 RLIVENLSSRVSWQDLKDFMRQAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRK 173
                            .|...:.|              |...||                     
  Fly   114 ----------------DDKCYECG--------------GRGHFA--------------------- 127

Mouse   174 IKLIEGSKRHSRSRSRSRSRTRSSSRSRSRSRSRRSKSYSRSRSRSRSRSKSRSGSRSPVPEKSQ 238
                    ||.|.| ::|.|.||:|.|||||.|||.::.|:|.:||||||....|.||.......
  Fly   128 --------RHCRER-KARQRRRSNSFSRSRSTSRRRRTRSKSGTRSRSRSAGSVGRRSGRSNGRD 183

Mouse   239 KRGSSSR-----SKSPASVD---------------------RQRSRSRSRSRSVDSGN 270
            :.||:||     .....:||                     |.||||||.|.:|..|:
  Fly   184 ENGSASRYSDHERNGSGAVDSPPPPKRRYEDEDDDRVRGSPRSRSRSRSASPAVRRGS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srsf5NP_001334344.1 RRM1_SRSF5 5..74 CDD:410008 32/76 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..105 8/49 (16%)
RRM2_SRSF5 99..179 CDD:410158 5/79 (6%)
x16NP_723226.1 RRM <1..>82 CDD:223796 31/72 (43%)
RRM_SRSF3_like 9..81 CDD:240819 31/71 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.