DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srsf3 and B52

DIOPT Version :9

Sequence 1:NP_038691.1 Gene:Srsf3 / 20383 MGIID:98285 Length:164 Species:Mus musculus
Sequence 2:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster


Alignment Length:286 Identity:77/286 - (26%)
Similarity:95/286 - (33%) Gaps:135/286 - (47%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 KVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCR 75
            :||||.|.....:.:|||.|..||..|.:.:..   |:.||||||.|||.|||.||:|:.|.|.|
  Fly     5 RVYVGGLPYGVRERDLERFFKGYGRTRDILIKN---GYGFVEFEDYRDADDAVYELNGKELLGER 66

Mouse    76 VRVELSNGEKRSRNR-------------------------------GPP---------------P 94
            |.||.:.|..|..||                               |||               .
  Fly    67 VVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSRV 131

Mouse    95 SW--------------------------------------------------------------- 96
            ||                                                               
  Fly   132 SWQDLKDYMRQAGEVTYADAHKQRRNEGVVEFASLSDMKTAIEKLDDTELNGRRIHLVEDRRGGR 196

Mouse    97 ---------GRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRR---------RERSLSRER 143
                     ||......|.||...||...||.|.|||:|||.|:.|.         :.||.||.|
  Fly   197 SGGGGGSGRGRSRSSSSRSRSRSRRRSRSRRSSHSRSKSRSRSKSRGGRSKSKSPVKSRSRSRSR 261

Mouse   144 NHK-----PSRSFSRSRSRSRSNERK 164
            ::|     .|:|.|.||:||||.:|:
  Fly   262 SNKSRDVSKSKSKSHSRTRSRSPKRE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srsf3NP_038691.1 Sufficient for interaction with NXF1. /evidence=ECO:0000250 1..90 36/78 (46%)
RRM_SRSF3 6..86 CDD:241089 35/74 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..164 42/214 (20%)
2 X approximate repeats, basic 119..164 24/58 (41%)
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 34/71 (48%)
RRM2_SRSF4_like 120..191 CDD:241044 2/70 (3%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.