Sequence 1: | NP_038691.1 | Gene: | Srsf3 / 20383 | MGIID: | 98285 | Length: | 164 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014619.2 | Gene: | B52 / 41670 | FlyBaseID: | FBgn0004587 | Length: | 355 | Species: | Drosophila melanogaster |
Alignment Length: | 286 | Identity: | 77/286 - (26%) |
---|---|---|---|
Similarity: | 95/286 - (33%) | Gaps: | 135/286 - (47%) |
- Green bases have known domain annotations that are detailed below.
Mouse 11 KVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCR 75
Mouse 76 VRVELSNGEKRSRNR-------------------------------GPP---------------P 94
Mouse 95 SW--------------------------------------------------------------- 96
Mouse 97 ---------GRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRR---------RERSLSRER 143
Mouse 144 NHK-----PSRSFSRSRSRSRSNERK 164 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Srsf3 | NP_038691.1 | Sufficient for interaction with NXF1. /evidence=ECO:0000250 | 1..90 | 36/78 (46%) | |
RRM_SRSF3 | 6..86 | CDD:241089 | 35/74 (47%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 81..164 | 42/214 (20%) | |||
2 X approximate repeats, basic | 119..164 | 24/58 (41%) | |||
B52 | NP_001014619.2 | RRM1_SRSF4_like | 5..74 | CDD:240783 | 34/71 (48%) |
RRM2_SRSF4_like | 120..191 | CDD:241044 | 2/70 (3%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |