DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srsf2 and RnpS1

DIOPT Version :9

Sequence 1:NP_035488.1 Gene:Srsf2 / 20382 MGIID:98284 Length:221 Species:Mus musculus
Sequence 2:NP_649903.1 Gene:RnpS1 / 41147 FlyBaseID:FBgn0037707 Length:374 Species:Drosophila melanogaster


Alignment Length:156 Identity:58/156 - (37%)
Similarity:71/156 - (45%) Gaps:28/156 - (17%)


- Green bases have known domain annotations that are detailed below.


Mouse    16 LKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKE-SRGFAFVRFHDKRDAEDAMDAMDGAV 79
            :.|..||...:.|.:..:|..:|.|.:|..|.||:... .||.|||.:....|.|.||..|||..
  Fly   221 IHVGRLTRNVTKDHVFEIFSSFGDVKNVEFPVDRFHPNFGRGVAFVEYATPEDCESAMKHMDGGQ 285

Mouse    80 LDGRELRVQ--MARYGRPPDSHHSRRGPPPRRY--------------------GGGGYGRRSRSP 122
            :||:|:.|.  :....|||    .||..||.|.                    ||||.|.|.:||
  Fly   286 IDGQEITVSPVVLVKQRPP----MRRPSPPMRRPQNNRWRSPPQFNRFNNRGGGGGGGGGRRQSP 346

Mouse   123 RRRRRS-RSRSRSRSRSRSRSRYSRS 147
            .|.||| |.||||..|.|.||..|.|
  Fly   347 MRNRRSPRRRSRSPIRRRRRSNSSDS 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srsf2NP_035488.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 26/72 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..221 31/77 (40%)
RnpS1NP_649903.1 RRM <196..>301 CDD:223796 27/79 (34%)
RRM_RNPS1 221..294 CDD:240811 26/72 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1169
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.