DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srsf2 and CG10466

DIOPT Version :9

Sequence 1:NP_035488.1 Gene:Srsf2 / 20382 MGIID:98284 Length:221 Species:Mus musculus
Sequence 2:NP_001260601.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:96 Identity:29/96 - (30%)
Similarity:45/96 - (46%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


Mouse    18 VDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAMDGAVLDG 82
            |....|..:...|..||.:||.|.::.:.||..|.:|:||.|:.:.|:|....|:|.::|..:..
  Fly    38 VAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILD 102

Mouse    83 RELRVQMARYGRPPDSHHSRRGPPPRRYGGG 113
            |.|||......:||..:........|.|..|
  Fly   103 RTLRVDHVADYKPPKENEKMDEET
LRLYMEG 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srsf2NP_035488.1 RRM_SRSF2_SRSF8 16..88 CDD:409751 23/69 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..221 5/22 (23%)
CG10466NP_001260601.1 RRM_ist3_like 25..113 CDD:240857 24/74 (32%)
RRM <36..>126 CDD:223796 26/87 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.