DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Srsf2 and CG10466

DIOPT Version :10

Sequence 1:NP_035488.1 Gene:Srsf2 / 20382 MGIID:98284 Length:221 Species:Mus musculus
Sequence 2:NP_610003.1 Gene:CG10466 / 35268 FlyBaseID:FBgn0032822 Length:154 Species:Drosophila melanogaster


Alignment Length:140 Identity:27/140 - (19%)
Similarity:43/140 - (30%) Gaps:50/140 - (35%)


- Green bases have known domain annotations that are detailed below.


Mouse   140 RLLNQRMEKRLSENSPDSSLSLSLS----------VTGSYTELPTLPRFPGP-----------QV 183
            |.|.......::..||...|..:|:          .:|||........|.|.           ::
  Fly    10 RTLFSNSSPSIAHRSPRIGLPTNLNPKILISRRCLSSGSYVSEMQKSAFQGNILRLIRNEIEYEL 74

Mouse   184 SHSPPAQRRPRAHRIIISSPVSQSQLGSESASSPSAVSETSDGQLSIKLKQRRSNDEE------- 241
            .||||.|                    ..::..|..|.| ..|:..|.||:...:.|:       
  Fly    75 DHSPPLQ--------------------PPNSFGPFTVDE-RPGEQWISLKRNFGDKEDIKIEATM 118

Mouse   242 -EKRRPVSQS 250
             ::..|.|:|
  Fly   119 FDRSVPTSKS 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Srsf2NP_035488.1 RRM_SRSF2_SRSF8 16..88 CDD:409751
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..221 17/101 (17%)
CG10466NP_610003.1 RRM_ist3_like 25..113 CDD:409845 21/108 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.