DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfrp4 and fz2

DIOPT Version :9

Sequence 1:NP_057896.1 Gene:Sfrp4 / 20379 MGIID:892010 Length:351 Species:Mus musculus
Sequence 2:NP_001262037.1 Gene:fz2 / 40090 FlyBaseID:FBgn0016797 Length:806 Species:Drosophila melanogaster


Alignment Length:124 Identity:55/124 - (44%)
Similarity:81/124 - (65%) Gaps:6/124 - (4%)


- Green bases have known domain annotations that are detailed below.


Mouse    24 CEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSSVLRFFLCAMYAPICTLE 88
            ||.:.|||||.:.:|:|..||.::|.||:.|.|.:.|:..||::.||..|:||||:||.||| ||
  Fly    64 CEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPIC-LE 127

Mouse    89 FLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLP 147
            ..|.|:..|:|||:|||..|.|:|:.|:..|||.:||:.||::.     .|:.:..:.|
  Fly   128 DYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHG-----DPDNLCMEQP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfrp4NP_057896.1 CRD_FZ 20..146 CDD:295308 54/121 (45%)
NTR_like 188..296 CDD:295338
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..351
fz2NP_001262037.1 CRD_FZ5_like 63..182 CDD:143565 55/124 (44%)
Frizzled 308..618 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831143
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11309
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.