DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfrp1 and fz

DIOPT Version :9

Sequence 1:NP_038862.2 Gene:Sfrp1 / 20377 MGIID:892014 Length:314 Species:Mus musculus
Sequence 2:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster


Alignment Length:215 Identity:71/215 - (33%)
Similarity:103/215 - (47%) Gaps:48/215 - (22%)


- Green bases have known domain annotations that are detailed below.


Mouse    62 PVDLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHMGTQVFLCSLFAPVC--LDR 124
            |:.:.:|.|:.|...::|||:.|....|...:...:.||:...|....|:|||||:.|||  |:|
  Fly    55 PITISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLVKIGCSDDLQLFLCSLYVPVCTILER 119

Mouse   125 PIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFP-EG--DVCIAMTPPNTTEASKPQGTTVC 186
            ||.|||.|||:.| .||.:|:.:.|.|||.|:|.||| .|  |:|:|   .|||.::....|.. 
  Fly   120 PIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVHGGEDLCVA---EN
TTSSASTAATPT- 179

Mouse   187 PPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKK-------IVP-KKKKPLKLGPIKKKEL 243
                   :|.|              |:...|.:.|.:.       :.| :.|.||.:|    .||
  Fly   180 -------RSVA--------------KVTTRKHQTGVESPHRNIGFVCPVQLKTPLGMG----YEL 219

Mouse   244 KRLVLFLKNGADC--PCHQL 261
            |   :..|:..||  |||.:
  Fly   220 K---VGGKDLHDCGAPCHAM 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfrp1NP_038862.2 CRD_SFRP1 52..175 CDD:143552 49/117 (42%)
NTR_Sfrp1_like 183..306 CDD:239635 20/89 (22%)
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 48/115 (42%)
Frizzled 237..564 CDD:279827 71/215 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.