DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfrp2 and fz

DIOPT Version :9

Sequence 1:NP_033170.1 Gene:Sfrp2 / 20319 MGIID:108078 Length:295 Species:Mus musculus
Sequence 2:NP_001261836.1 Gene:fz / 45307 FlyBaseID:FBgn0001085 Length:612 Species:Drosophila melanogaster


Alignment Length:164 Identity:53/164 - (32%)
Similarity:78/164 - (47%) Gaps:10/164 - (6%)


- Green bases have known domain annotations that are detailed below.


Mouse    19 LGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLV 83
            |.::.|..|.|.|    ..:.|:||  .:.:|..|.|....:|||:||...:|...:...:.|||
  Fly    36 LMASSGTELDGLP----HHNRCEPI--TISICKNIPYNMTIMPNLIGHTKQEEAGLEVHQFAPLV 94

Mouse    84 MKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFP-- 146
            ...|..|.:.|||||:.||| ..|:..|.||.|||...: .|..:|..:.|.||:.|||.:||  
  Fly    95 KIGCSDDLQLFLCSLYVPVC-TILERPIPPCRSLCESAR-VCEKLMKTYNFNWPENLECSKFPVH 157

Mouse   147 QDNDLCIPLASSDHLLPATEEAPKVCEACKTKNE 180
            ...|||:...::.....|......|.:....|::
  Fly   158 GGEDLCVAENTTSSASTAATPTRSVAKVTTRKHQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sfrp2NP_033170.1 CRD_SFRP2 36..163 CDD:143555 45/128 (35%)
NTR_Sfrp1_like 169..295 CDD:239635 2/12 (17%)
fzNP_001261836.1 CRD_FZ1_like 51..167 CDD:143567 45/119 (38%)
Frizzled 237..564 CDD:279827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3577
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.