DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpinf1 and Spn42Dd

DIOPT Version :9

Sequence 1:NP_035470.3 Gene:Serpinf1 / 20317 MGIID:108080 Length:417 Species:Mus musculus
Sequence 2:NP_001163067.1 Gene:Spn42Dd / 49808 FlyBaseID:FBgn0028988 Length:372 Species:Drosophila melanogaster


Alignment Length:381 Identity:115/381 - (30%)
Similarity:184/381 - (48%) Gaps:34/381 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    50 VNKLAAAVSNFGYDLYRLRSSASPTGNVLLSPLSVATALSALSLGAEHRTESVIHRALYYDLITN 114
            |..:|...|.   ::|:|.|.:....|:::||:|:.|.||.:.:|||..|...:..||.......
  Fly    10 VTSVACQTSK---EIYQLLSKSHTNQNLVVSPVSIETILSMVFMGAEGSTAKELQSALGLPSEDK 71

Mouse   115 PDIHSTYKELLASVTAPEKN--LKSASRIVFERKLRVKSSFVAPLEKSYGTRPR--ILTGNPRVD 175
            ..:.:.|..||..:...|:.  ||.|:||....:..:..::...:.:.:.:...  .||..| |.
  Fly    72 EAVAARYGALLNDLQGQEEGPILKLANRIYVNDQYSLNQNYNLAVREPFKSEAESISLTNGP-VA 135

Mouse   176 LQEINNWVQAQMKGKIAR--STREMPSALSILLLGVAYFKGQWVTKFDSRKTTLQDFHLDEDRTV 238
            .:.||.||..|..|||..  ....|.|.:..||:...||||||.:|||..||....|.:..:::|
  Fly   136 AERINQWVLDQTSGKIKGMIDPGSMTSDVKALLVNAIYFKGQWESKFDPAKTRASTFQVTANKSV 200

Mouse   239 RVPMMSDPKAILRYGLDSDLNCKIAQLP-LTGSMSIIFFLPLTVTQNLTMIEESLTSEFIHDIDR 302
            .|.||:. ....|.....||:.::.:|| |..::|:..|||..| :.|:.:||.:..     ..|
  Fly   201 PVQMMAQ-MGTFRANYFRDLDAQVIELPYLNSNLSMTIFLPREV-EGLSALEEKIVG-----FAR 258

Mouse   303 ELKTIQAVLTVPKLKLSFEGELTKSLQDMKLQSLFESPDFSKITG-----KPVKLTQVEHRAAFE 362
            .|...:..|.:||.|:.|..||.::|:.:.::.||  .|.|.::|     ...|::||.|:|..|
  Fly   259 PLVAKEVYLKLPKFKIEFRDELKETLEKLGIRELF--TDKSDLSGLFADKSGGKVSQVSHKAFLE 321

Mouse   363 WNEEGAGSSPSPGLQPVRLT----FPLDYHLNQPFLFVLRDTDTGALLFIGRILDP 414
            .|||||.::   |...|.:|    |......:.||.||:||.:|  :.|.||::.|
  Fly   322 VNEEGAEAA---GATSVAVTNRAGFSTFLMADHPFAFVIRDANT--IYFQGRVVSP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpinf1NP_035470.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..41
PEDF 39..414 CDD:239007 114/379 (30%)
Spn42DdNP_001163067.1 SERPIN 16..369 CDD:238101 111/370 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.