DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUBB and betaTub97EF

DIOPT Version :10

Sequence 1:NP_001280141.1 Gene:TUBB / 203068 HGNCID:20778 Length:464 Species:Homo sapiens
Sequence 2:NP_651606.2 Gene:betaTub97EF / 43359 FlyBaseID:FBgn0003890 Length:457 Species:Drosophila melanogaster


Alignment Length:31 Identity:10/31 - (32%)
Similarity:17/31 - (54%) Gaps:2/31 - (6%)


- Green bases have known domain annotations that are detailed below.


Human   163 GLLPISF--NLLSLLQAVLRAIIAICHLFWD 191
            ||:.|.|  ..::|:.|...|:|...:|.:|
  Fly   166 GLIAIFFPGKTITLVYASAGALIFSIYLVYD 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUBBNP_001280141.1 PLN00220 39..449 CDD:215107 10/31 (32%)
betaTub97EFNP_651606.2 PLN00220 1..444 CDD:215107 10/31 (32%)

Return to query results.
Submit another query.