DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TUBB and alphaTub84D

DIOPT Version :9

Sequence 1:NP_001280141.1 Gene:TUBB / 203068 HGNCID:20778 Length:464 Species:Homo sapiens
Sequence 2:NP_524264.1 Gene:alphaTub84D / 40904 FlyBaseID:FBgn0003885 Length:450 Species:Drosophila melanogaster


Alignment Length:458 Identity:179/458 - (39%)
Similarity:268/458 - (58%) Gaps:20/458 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    15 RSGVRDHPGQQSETLPHATFLQKIKFWEVISDEHGIDPTGTYHGDSDL--QLDRISVYYNEATGG 77
            |..:..|.||....:.:|.       ||:...||||.|.|....|..:  ..|..:.:::|...|
  Fly     2 RECISIHVGQAGVQIGNAC-------WELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAG 59

Human    78 KYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRK 142
            |:||||:.|||||..:|.||:|.:.|:|.|:..:.|:..|.||:|:||||.|.|:||.|||.:||
  Fly    60 KHVPRAVFVDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRK 124

Human   143 EAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATL 207
            .|:.|..||||.:.||.|||||||..:||:.::..:|..:....|:|.|:|:||..||||||:.|
  Fly   125 LADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSIL 189

Human   208 SVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRK 272
            :.|..:|::|..:.:||||:||||.|.|.:..|||.:||.|:...:|.:|..|||.|.||.||.:
  Fly   190 TTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTE 254

Human   273 LAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQVFDAKNMMAACDPRHGRYLTVAAVF 337
            ...|:||:||:||.:..:||:.|.....:..|:|.|:|...|:..|.|...|||||:|:....::
  Fly   255 FQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKVDPRHGKYMACCMLY 319

Human   338 RGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP--------RGLKMAVTFIGNSTAI 394
            ||.:..|:|:..:..::.|.:..||:|.|...|..:...||        ..::.||..:.|:|||
  Fly   320 RGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAI 384

Human   395 QELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEDFGEE 459
            .|.:.|:..:|..|:.::||:|||.||||:|.||:||.   .||.:..:.|::...:..:..||.
  Fly   385 AEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAR---EDLAALEKDYEEVGMDSGDGEGEG 446

Human   460 AEE 462
            |||
  Fly   447 AEE 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TUBBNP_001280141.1 PLN00220 39..449 CDD:215107 169/419 (40%)
beta_tubulin 39..446 CDD:276956 168/416 (40%)
alphaTub84DNP_524264.1 PTZ00335 1..439 CDD:185562 174/446 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.