DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scx and Fer3

DIOPT Version :9

Sequence 1:XP_006520723.1 Gene:Scx / 20289 MGIID:102934 Length:232 Species:Mus musculus
Sequence 2:NP_524322.1 Gene:Fer3 / 41411 FlyBaseID:FBgn0037937 Length:195 Species:Drosophila melanogaster


Alignment Length:192 Identity:54/192 - (28%)
Similarity:70/192 - (36%) Gaps:70/192 - (36%)


- Green bases have known domain annotations that are detailed below.


Mouse     7 RSAPPPGRYLYPE-----------------VSPL----SEDEDRGSESSGSDEKPCRVHAARCGL 50
            :.||||....|.|                 |:||    .....|.:.||.|.:|           
  Fly    24 QEAPPPPIVPYQELIAGFPCTDLSLWQRSQVTPLVPQRPSTNGRANGSSSSSKK----------- 77

Mouse    51 QGARRRAGGRRAAGSGPGPGGRPGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLS 115
              .|||....                 .||..||.|||.|..::|.||..||..:||...:::||
  Fly    78 --TRRRVASM-----------------AQRRAANIRERRRMFNLNEAFDKLRRKVPTFAYEKRLS 123

Mouse   116 KIETLRLASSYISHLGNVLLVGEACGDGQPCHSGPAFFHSGRA-------GSPLPPPPPPPP 170
            :|||||||.:||..:..:|       .|.|.:|     |..|:       |....|||...|
  Fly   124 RIETLRLAITYIGFMAELL-------SGTPSNS-----HKSRSDVYGSMNGHHQAPPPAIHP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScxXP_006520723.1 bHLH_TS_scleraxis 76..143 CDD:381521 27/66 (41%)
Fer3NP_524322.1 HLH 87..135 CDD:278439 24/47 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.