DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scx and HLH4C

DIOPT Version :10

Sequence 1:XP_006520723.1 Gene:Scx / 20289 MGIID:102934 Length:232 Species:Mus musculus
Sequence 2:NP_001259243.1 Gene:HLH4C / 31397 FlyBaseID:FBgn0011277 Length:191 Species:Drosophila melanogaster


Alignment Length:69 Identity:34/69 - (49%)
Similarity:44/69 - (63%) Gaps:9/69 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    75 REPRQR--------HTANA-RERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRLASSYISHL 130
            ||.|:|        .||:| |||.|..:.|.:|..||.|:||.|.|:||||||.|:||..||::|
  Fly    96 REERRRRRRATLKYRTAHATRERIRVEAFNVSFAELRKLLPTLPPDKKLSKIEILKLAICYIAYL 160

Mouse   131 GNVL 134
            .:||
  Fly   161 NHVL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScxXP_006520723.1 bHLH_TS_scleraxis 76..143 CDD:381521 33/68 (49%)
HLH4CNP_001259243.1 bHLH_TS_HEN1 105..165 CDD:381544 30/60 (50%)

Return to query results.
Submit another query.