DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ENPEP and CG4467

DIOPT Version :10

Sequence 1:NP_001968.3 Gene:ENPEP / 2028 HGNCID:3355 Length:957 Species:Homo sapiens
Sequence 2:NP_001036747.1 Gene:CG4467 / 42747 FlyBaseID:FBgn0039064 Length:1125 Species:Drosophila melanogaster


Alignment Length:193 Identity:42/193 - (21%)
Similarity:63/193 - (32%) Gaps:64/193 - (33%)


- Green bases have known domain annotations that are detailed below.


Human   807 PSQPVFAPMLQSNPRM----------LTSGSHP-----QAIVSSSTPQYPAAEQPTPQALYATVH 856
            ||....||..:.|..:          :||....     |.::::........:|.||:|..||  
  Fly    22 PSAAALAPSTRDNTSLHERLTALESTITSRDEELAKMLQLLLTNQREILRLLQQDTPKAFCAT-- 84

Human   857 QSYPHHATQLHGHQPQPATTPTGSQPQSQHAAPSPVQHQAGQAPHLGSGQPQQNLYHPGALTGTP 921
                      .|.|.||:|.||         .|....|..            .|..|||:|.   
  Fly    85 ----------DGTQHQPSTQPT---------RPCNRDHSF------------TNSLHPGSLQ--- 115

Human   922 PSLPPGPSAQSPQSSFPQPAAVYAIHPH--QQLPHGFTNMAHVTQAHVQTGVTAAPPPHPGAP 982
               |||.:.....:::.|.|.....||.  :::|.|.:....:        ..:|.|..||.|
  Fly   116 ---PPGNATAPSTAAYRQEAHPAGTHPRSCREIPDGMSGEELI--------YPSAGPAGPGEP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ENPEPNP_001968.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..83
M1_APN-Q_like 100..540 CDD:341064
ERAP1_C 616..934 CDD:463368 31/141 (22%)
CG4467NP_001036747.1 GluZincin 145..677 CDD:472708 7/31 (23%)
ERAP1_C 783..1078 CDD:463368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.