DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Serpinb3a and Spn88Eb

DIOPT Version :9

Sequence 1:NP_033152.3 Gene:Serpinb3a / 20248 MGIID:3573933 Length:387 Species:Mus musculus
Sequence 2:NP_650427.1 Gene:Spn88Eb / 41829 FlyBaseID:FBgn0038299 Length:426 Species:Drosophila melanogaster


Alignment Length:407 Identity:112/407 - (27%)
Similarity:200/407 - (49%) Gaps:56/407 - (13%)


- Green bases have known domain annotations that are detailed below.


Mouse    11 FTLELYRQLRE--SDNNIFYSPISMMTALAMLQLGAKGNTEKQIEKVLQFNETTKKTTEKSAHCH 73
            |:|.|.:|:||  ...|:|:||.|...||.:....:...||:::.:.|.......|.....::..
  Fly    41 FSLALMKQIREIYPSGNLFFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTL 105

Mouse    74 DEENVHEQFQKLMTQLNKSNDAY---DLKAANS----IYGAKGFPFVQTFLEDIKEYYQANVESL 131
            .:.....::::...:|:.:|..:   .:..:|.    :|||                    .:.|
  Fly   106 AQRQDEFRWRQSPMELSSANRIFVDRTINVSNKFNTLLYGA--------------------TKEL 150

Mouse   132 DFEHAAEESEKKINSWVESQTNGKIKDLFPNGSLNRSTIMVLVNAVYFKGQWNHKFDEKHTTEEK 196
            ||::..|...|:||.|:..:|:.:|:|:..:..:...|::||.||.|.||||..:|..:.|..:.
  Fly   151 DFKNDPETGLKEINDWIADKTHNQIRDMLSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKP 215

Mouse   197 FWLNKNTSKPVQMMKQNIEFNFMFLEDVQAKIVEIP----YKGKE-----------LSMIVLLP- 245
            |::|:...:.|.||.:...|.....|.:|::|:::|    ||.||           :|||::|| 
  Fly   216 FFINEREQEMVYMMHKTGAFKMTIDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPN 280

Mouse   246 ---VEINGLKQLEEQLTADKLLEWTRAENMHMTELYLSLPRFKVDEKYDLPIPLEHMGMVDAFDP 307
               :.:|   ::..:|.||.:.:|  .|.....::.||||:|:.:::.:|...|..|| |:....
  Fly   281 SNKISLN---RVISRLNADSVKKW--FERALPQKIELSLPKFQFEQRLELTPILSLMG-VNTMFT 339

Mouse   308 QKADFSGMSSTQ-GLVVSKVLHKSFVEVNEEGTEAAAATGVEVSLTSAQ-IAEDFCCDHPFLFFI 370
            :.|.|..:::.. .||:....|.:.::|:|.|:.|||||.:.||.:|.| ....|.|:|||:|.|
  Fly   340 RNATFGDLTADPISLVIDDAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLI 404

Mouse   371 IHRKTNSILFFGRISSP 387
            ...|.::|||.|..|.|
  Fly   405 YDEKVDTILFAGVYSDP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Serpinb3aNP_033152.3 SERPIN 5..387 CDD:294093 111/405 (27%)
Spn88EbNP_650427.1 SERPIN 37..418 CDD:238101 110/402 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.