DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment STK32A and S6k

DIOPT Version :9

Sequence 1:NP_001274669.1 Gene:STK32A / 202374 HGNCID:28317 Length:407 Species:Homo sapiens
Sequence 2:NP_001261450.1 Gene:S6k / 38654 FlyBaseID:FBgn0283472 Length:490 Species:Drosophila melanogaster


Alignment Length:388 Identity:114/388 - (29%)
Similarity:189/388 - (48%) Gaps:61/388 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    23 FEILRAIGKGSFGKVCIVQK---NDTKKMYAMKYMNKQKCV-ERNEVRNVFKELQIMQGLEHPFL 83
            ||:.:.:|||.:|||..|:|   .|..|.:|||.:.|...| .:.:..:...|..|::.::|||:
  Fly    77 FELKKVLGKGGYGKVFQVRKTAGRDANKYFAMKVLKKASIVTNQKDTAHTRAERNILEAVKHPFI 141

Human    84 VNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFKEETVKLFICELVMALDYLQNQRIIHRDMK 148
            |.|.|:||.:..::::::.|.||:|..||::...|.|:|...::.|:::||.:|....||:||:|
  Fly   142 VELVYAFQTDGKLYLILEYLSGGELFMHLEREGIFLEDTTCFYLSEIILALGHLHKLGIIYRDLK 206

Human   149 PDNILLDEHGHVHITDFNIAAMLPRETQIT-TMAGTKPYMAPEMFSSRKGAGYSFAVDWWSLGVT 212
            |:|||||..|||.:|||.:.....:|..:| |..||..|||||:.:.   :|:..||||||||..
  Fly   207 PENILLDAQGHVKLTDFGLCKEHIQEGIVTHTFCGTIEYMAPEILTR---SGHGKAVDWWSLGAL 268

Human   213 AYELLRGRRPYHIRSSTSSKEIVHTFETTVVTYPSAWSQEMVSLLKKLLEPNPDQRF----SQLS 273
            .:::|.|..|:   ::.:.|:.:.|.....:..|:..:.|...|:::|::....||.    ...:
  Fly   269 MFDMLTGVPPF---TAENRKKTIETILKAKLNLPAYLTPEARDLVRRLMKRQEPQRLGSGPEDAA 330

Human   274 DVQNFPYMNDINWDAVFQKRLIPGFIPNKGRLNCDPTFELEEMILESKPLHKKKKRLAKKEKDMR 338
            .||..|:...:|||.|..:||.|                         |:    |.|.:.|.|:.
  Fly   331 AVQIHPFFKHVNWDDVLARRLEP-------------------------PI----KPLLRSEDDVS 366

Human   339 K----------CDSSQTCLLQEHLDSVQKEF------IIFNREKVNRDFNKRQPNLALEQTKD 385
            :          .||.....|.|..:.:.:.|      |:.:..:.|| ...|.|.....|..|
  Fly   367 QFDTRFTRQIPVDSPDDTTLSESANLIFQGFTYVAPSILEDMHRANR-MPARSPRRTPRQLPD 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
STK32ANP_001274669.1 STKc_Yank1 22..281 CDD:270730 90/266 (34%)
S6kNP_001261450.1 PTZ00263 76..397 CDD:140289 106/354 (30%)
STKc_p70S6K 81..402 CDD:270736 105/355 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0598
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.