Sequence 1: | NP_033149.1 | Gene: | Nkx1-2 / 20231 | MGIID: | 104806 | Length: | 305 | Species: | Mus musculus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477146.1 | Gene: | unpg / 35942 | FlyBaseID: | FBgn0015561 | Length: | 485 | Species: | Drosophila melanogaster |
Alignment Length: | 204 | Identity: | 66/204 - (32%) |
---|---|---|---|
Similarity: | 92/204 - (45%) | Gaps: | 48/204 - (23%) |
- Green bases have known domain annotations that are detailed below.
Mouse 51 EEVEAGQDACSGNPIGSQETPDAVGRGIDPGSPVEGSEAEEEEEAEDAGRAHQPERWQGVHEGSP 115
Mouse 116 EARAVAVGTEESGAEGLPASPGSPGSPRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRATRY 180
Mouse 181 LSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADGAVQAGGGAPQPGTPGAVAGGGGSAT 245
Mouse 246 GSSPGPPVP 254 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Nkx1-2 | NP_033149.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 51..158 | 21/106 (20%) | |
Homeobox | 160..212 | CDD:278475 | 33/51 (65%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 210..257 | 11/45 (24%) | |||
unpg | NP_477146.1 | Homeobox | 324..375 | CDD:278475 | 32/50 (64%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |