DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nkx1-2 and unpg

DIOPT Version :9

Sequence 1:NP_033149.1 Gene:Nkx1-2 / 20231 MGIID:104806 Length:305 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg / 35942 FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster


Alignment Length:204 Identity:66/204 - (32%)
Similarity:92/204 - (45%) Gaps:48/204 - (23%)


- Green bases have known domain annotations that are detailed below.


Mouse    51 EEVEAGQDACSGNPIGSQETPDAVGRGIDPGSPVEGSEAEEEEEAEDAGRAHQPERWQGVHEGSP 115
            |:.|...|:||  .|....:|......:|.......:.::.|:.::|.|.       |..|||. 
  Fly   247 EDFECSGDSCS--DISLTMSPRNYNGEMDKSRNGAYTNSDSEDCSDDEGA-------QSRHEGG- 301

Mouse   116 EARAVAVGTEESGAEGLPASPGSPGSPRPRRRRAESSCAKPRRARTAFTYEQLVALENKFRATRY 180
                 .:|.::|...|                  .||.:|.||.|||||.|||:.||.:|.|.:|
  Fly   302 -----GMGGKDSQGNG------------------SSSNSKSRRRRTAFTSEQLLELEREFHAKKY 343

Mouse   181 LSVCERLNLALSLSLTETQVKIWFQNRRTKWKKQNPGADGAVQAGGGAPQPGTPGAVAGGGGSAT 245
            ||:.||..:|.||.|:|.||||||||||.|||:        |:|       |......|..|:.:
  Fly   344 LSLTERSQIATSLKLSEVQVKIWFQNRRAKWKR--------VKA-------GLTSHGLGRNGTTS 393

Mouse   246 GSSPGPPVP 254
            |:....|:|
  Fly   394 GTKIVVPIP 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nkx1-2NP_033149.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..158 21/106 (20%)
Homeobox 160..212 CDD:278475 33/51 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..257 11/45 (24%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 32/50 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.