DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sag and Arr1

DIOPT Version :9

Sequence 1:NP_033144.1 Gene:Sag / 20215 MGIID:98227 Length:403 Species:Mus musculus
Sequence 2:NP_001246073.1 Gene:Arr1 / 35078 FlyBaseID:FBgn0000120 Length:364 Species:Drosophila melanogaster


Alignment Length:357 Identity:158/357 - (44%)
Similarity:225/357 - (63%) Gaps:11/357 - (3%)


- Green bases have known domain annotations that are detailed below.


Mouse    13 IFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGVVLVDPELVK-GKKVYVTLTCAFRYGQEDIDVM 76
            :|||.|.:..:|:|:.:||:||.|:||||:||::::|.|.|: .:|::|.|.|.||||:||.:::
  Fly     7 VFKKCSPNNMITLYMNRRDFVDSVTQVEPIDGIIVLDDEYVRQNRKIFVQLVCNFRYGREDDEMI 71

Mouse    77 GLTFRRDLYFSRVQVYPPVGAMSVLTQLQESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDVG 141
            ||.|:::|.....||.||......||::||.||||||.|.|||::..|...|.||:||....|..
  Fly    72 GLRFQKELTLVSQQVCPPQKQDIQLTKMQERLLKKLGSNAYPFVMQMPPSSPASVVLQQKASDES 136

Mouse   142 KSCGVDFEVKAFASDITDPEEDKIPKKSSVRLLIRKVQHAPPEMGPQPSAEASWQFFMSDKPLNL 206
            :.|||.:.||.|..   |.:.|:..::|::.|.|||||:||.:.|.||.......|.:|...|.|
  Fly   137 QPCGVQYFVKIFTG---DSDCDRSHRRSTINLGIRKVQYAPTKQGIQPCTVVRKDFLLSPGELEL 198

Mouse   207 SVSLSKEIYFHGEPIPVTVTVTNNTDKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQE--KV 269
            .|:|.|::|.|||.|.|.:.|.||::|||||||..|:|..:|||:.:..:...:|..||.|  .:
  Fly   199 EVTLDKQLYHHGEKISVNICVRNNSNKVVKKIKAMVQQGVDVVLFQNGQFRNTIAFMETSEGCPL 263

Mouse   270 QPNSTLTKTLVLVPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVMGILVSYHIKVKL 334
            .|.|:|.|.:.|||.|..|.:|.|||::|.||.:||.|||:|:|.....|...||:|||.:||||
  Fly   264 NPGSSLQKVMYLVPTLVANCDRAGIAVEGDIKRKDTALASTTLIASQDARDAFGIIVSYAVKVKL 328

Mouse   335 TVSGFLGELTSSEVATEVPFRLMHPQPEDPAK 366
                |||.| ..|:..|:||.||||:|...|:
  Fly   329 ----FLGAL-GGELCAELPFILMHPKPSRKAQ 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SagNP_033144.1 Interaction with RHO. /evidence=ECO:0000269|PubMed:28753425 11..19 3/5 (60%)
Arrestin_N 23..181 CDD:334019 70/158 (44%)
Arrestin_C 200..361 CDD:214976 76/162 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..403
Arr1NP_001246073.1 Arrestin_N 17..173 CDD:304627 70/158 (44%)
Arrestin_C 192..350 CDD:214976 76/162 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3865
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52566
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11792
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.