DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EN1 and zen2

DIOPT Version :10

Sequence 1:NP_001417.3 Gene:EN1 / 2019 HGNCID:3342 Length:392 Species:Homo sapiens
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:93 Identity:36/93 - (38%)
Similarity:58/93 - (62%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   298 KNEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQTLAQELSLNESQIKIWFQNKRAKIKKAT 362
            ::.::.||.||||::.||..|:.||..|:|:...||..::|.|:|.|.|:||||||:|.|:||:|
  Fly    38 RSSEKSKRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKKST 102

Human   363 GIKNGLALHLMAQGLYNHSTTTVQDKDE 390
            ..|..:.....:..|.:.|:..:|..|:
  Fly   103 NRKGAIGALTTSIPLSSQSSEDLQKDDQ 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EN1NP_001417.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..100
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..164
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..251
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..306 1/7 (14%)
Homeodomain 305..360 CDD:459649 27/54 (50%)
Engrail_1_C_sig 361..391 CDD:431338 6/30 (20%)
zen2NP_476794.1 Homeodomain 44..100 CDD:459649 28/55 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.