DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dhrs3 and CG9265

DIOPT Version :9

Sequence 1:NP_035433.1 Gene:Dhrs3 / 20148 MGIID:1315215 Length:302 Species:Mus musculus
Sequence 2:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster


Alignment Length:284 Identity:103/284 - (36%)
Similarity:159/284 - (55%) Gaps:27/284 - (9%)


- Green bases have known domain annotations that are detailed below.


Mouse    14 LQMIYLVTKAAVGMVLPPKLRDLSRESVLITGGGRGIGRHLAREFAERGARKIVLWGRTEKCLKE 78
            ||.:|.:   |.|  .|.|  :|:.:..||||||.|:||.||....:.|. |:|:|...:|.:.|
  Fly    69 LQDLYYI---AFG--YPEK--ELNTDIALITGGGNGLGRLLAERLGKMGT-KVVIWDINKKGIAE 125

Mouse    79 TTEEIRQMGTECHYFICDVGNREEVYQMAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKS 143
            |.:.:.:.|..|..::.|:..:||||:.|..:|::|||||:|:|||.||.|..|:|:.|..:.:|
  Fly   126 TVQIVEEAGGYCKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERS 190

Mouse   144 QHVNTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFMESLTLGL-- 206
            .:||.:..|||||||||:|:|...|||..:.|:.....|...:|||.||.:|..|.|:|.|.|  
  Fly   191 FNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEV 255

Mouse   207 LDCPGVSATTVLPFH-TSTEMFQGMRVRFPNLFPPLKPETVARRTVDAVQQNQALLLLPWTMNIL 270
            |....:..|.:.||. .:|.||..:..|:   .|.|.|..||.|.:.|:::|:.|.::|..:.:|
  Fly   256 LGHTNIRTTCICPFFIQATGMFDDVNARW---VPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVL 317

Mouse   271 I-------------ILKSILPQAA 281
            :             :||.::|.|:
  Fly   318 LSFKWTFPWGCVGGLLKRLVPDAS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dhrs3NP_035433.1 PRK09072 35..288 CDD:236372 96/263 (37%)
17beta-HSDXI-like_SDR_c 53..281 CDD:187598 85/243 (35%)
CG9265NP_001260655.1 fabG 82..299 CDD:235546 88/222 (40%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 91/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X140
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.