DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CEP112 and Xport-A

DIOPT Version :10

Sequence 1:NP_001340058.1 Gene:CEP112 / 201134 HGNCID:28514 Length:956 Species:Homo sapiens
Sequence 2:NP_650846.1 Gene:Xport-A / 42373 FlyBaseID:FBgn0038749 Length:116 Species:Drosophila melanogaster


Alignment Length:113 Identity:24/113 - (21%)
Similarity:44/113 - (38%) Gaps:23/113 - (20%)


- Green bases have known domain annotations that are detailed below.


Human   553 KAHDLQSELD---KGKEDTQKKIHKFEEALKEKEEQLTRVTEVQRLQAQQADAALE--EFKRQVE 612
            |.|..:.:::   |||...:|..||.|:.:.||:::.........|:..:|...::  .|...:.
  Fly    22 KGHSGKDKVEGGGKGKSRDEKDKHKHEQKVDEKDDKDLNSGFGDYLRTPEAFEMMKLFVFANTIM 86

Human   613 LNSEKVYAEMKEQMEKVEADLTRSKSLREKQSKEFLWQLEDIRQRYEQ 660
            |.....:..:|||...|..                 | ||..|:.::|
  Fly    87 LIVTMAWPHIKEQFYMVNQ-----------------W-LESFREEHQQ 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CEP112NP_001340058.1 DUF4485 13..98 CDD:464345
Smc 302..>934 CDD:440809 24/113 (21%)
Xport-ANP_650846.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.