DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELK3 and pnt

DIOPT Version :9

Sequence 1:NP_005221.2 Gene:ELK3 / 2004 HGNCID:3325 Length:407 Species:Homo sapiens
Sequence 2:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster


Alignment Length:109 Identity:54/109 - (49%)
Similarity:74/109 - (67%) Gaps:4/109 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     5 ITLWQFLLQLLLDQKHEHLICWTSNDGEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRYYYDK 69
            |.||||||:||||:..:..|.||.:..||||...:|||:.||:||||..|||:||||.|||||||
  Fly   610 IQLWQFLLELLLDKTCQSFISWTGDGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYDK 674

Human    70 NIIKKVIGQKFVYKFVSFPEILKMDPHAVE--ISRESLLLQDSD 111
            |||.|..|:::||:||.  ::..:..|..|  :::..|.::..|
  Fly   675 NIIHKTAGKRYVYRFVC--DLQNLVGHTPEELVAKYDLKIEKKD 716

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELK3NP_005221.2 ETS 19..88 CDD:197710 39/68 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..253
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..298
CTBP-binding motif 273..277
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 50/84 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.