DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELK3 and Eip74EF

DIOPT Version :10

Sequence 1:NP_005221.2 Gene:ELK3 / 2004 HGNCID:3325 Length:407 Species:Homo sapiens
Sequence 2:NP_730288.1 Gene:Eip74EF / 39962 FlyBaseID:FBgn0000567 Length:883 Species:Drosophila melanogaster


Alignment Length:99 Identity:46/99 - (46%)
Similarity:71/99 - (71%) Gaps:3/99 - (3%)


- Green bases have known domain annotations that are detailed below.


Human     3 SAITLWQFLLQLLLDQKH-EHLICWTSND-GEFKLLKAEEVAKLWGLRKNKTNMNYDKLSRALRY 65
            |...||:|||:||.|::: ...|.||:.: |.|||:.::.|::|||:.|||.:|||:.:.|||||
  Fly   785 STTYLWEFLLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALRY 849

Human    66 YYDKNIIKKVIGQKFVYKFVSFP-EILKMDPHAV 98
            ||.:.|:.||.||:.||:||..| :|:::|.:.|
  Fly   850 YYQRGILAKVDGQRLVYQFVDVPKDIIEIDCNGV 883

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELK3NP_005221.2 ETS 19..88 CDD:197710 33/70 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..253
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 271..298
CTBP-binding motif 273..277
Eip74EFNP_730288.1 ETS 786..872 CDD:197710 41/85 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.