DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELK1 and Ets96B

DIOPT Version :9

Sequence 1:NP_001107595.1 Gene:ELK1 / 2002 HGNCID:3321 Length:428 Species:Homo sapiens
Sequence 2:NP_996290.1 Gene:Ets96B / 42952 FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster


Alignment Length:138 Identity:59/138 - (42%)
Similarity:84/138 - (60%) Gaps:12/138 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     4 SVTLWQFLLQLLRE-QGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYY 67
            |:.|||||:.||.| ..:...|:||.| |.||||::.|||||.|||:||:..||||||||:||||
  Fly   497 SLQLWQFLVALLDEPTTSASCIAWTGR-GMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYY 560

Human    68 YDKNIIRKVSGQKFVYKFVSYPEVA-----GCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTV 127
            |:|.|::||:|:::||:||..|:..     |..|.......:..:|.::....|.:     ||:.
  Fly   561 YEKGIMQKVNGERYVYRFVCDPDALFNMAYGHLTTGSGKGDQHQLTLSLAKTPPTS-----GDSQ 620

Human   128 SGKPGTPK 135
            :..|...|
  Fly   621 TQSPRVAK 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELK1NP_001107595.1 ETS 4..89 CDD:197710 50/85 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..149 4/15 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..205
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..358
Sufficient for interaction with MAD2L2. /evidence=ECO:0000269|PubMed:17296730 349..399
Ets96BNP_996290.1 ETS 497..583 CDD:197710 50/86 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X7531
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.