DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ELK1 and pnt

DIOPT Version :10

Sequence 1:NP_005220.2 Gene:ELK1 / 2002 HGNCID:3321 Length:428 Species:Homo sapiens
Sequence 2:NP_524461.2 Gene:pnt / 42757 FlyBaseID:FBgn0003118 Length:718 Species:Drosophila melanogaster


Alignment Length:82 Identity:52/82 - (63%)
Similarity:64/82 - (78%) Gaps:1/82 - (1%)


- Green bases have known domain annotations that are detailed below.


Human     5 VTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYD 69
            :.||||||:||.::.....||||. ||.||||.|.:||||.||:||||..|||:||||.||||||
  Fly   610 IQLWQFLLELLLDKTCQSFISWTG-DGWEFKLTDPDEVARRWGIRKNKPKMNYEKLSRGLRYYYD 673

Human    70 KNIIRKVSGQKFVYKFV 86
            ||||.|.:|:::||:||
  Fly   674 KNIIHKTAGKRYVYRFV 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ELK1NP_005220.2 ETS 4..89 CDD:197710 52/82 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..149
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..205
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..358
Sufficient for interaction with MAD2L2. /evidence=ECO:0000269|PubMed:17296730 349..399
pntNP_524461.2 SAM_PNT-ETS-1,2 179..250 CDD:188879
ETS 609..693 CDD:197710 52/82 (63%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.