DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABCA2 and CG11147

DIOPT Version :9

Sequence 1:NP_997698.1 Gene:ABCA2 / 20 HGNCID:32 Length:2466 Species:Homo sapiens
Sequence 2:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster


Alignment Length:465 Identity:113/465 - (24%)
Similarity:203/465 - (43%) Gaps:91/465 - (19%)


- Green bases have known domain annotations that are detailed below.


Human  2081 VKIENLTKVYKSRKIGRILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKMLTGDESTTGGEAFVN 2145
            |::.|..|.|.|:...:|: :::|.:.|..|..:||||.:|.|||:....:.|.....|||..|.
  Fly     4 VEVRNGYKYYGSKSNPKIV-LNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVL 67

Human  2146 GHSVLKELLQVQQS-LGYCPQCDALFDELTAREHLQLYTRLRGISWKDEARVVKWAL--EKLELT 2207
            |....:....|..| :|:.||..||.:|:|.:|.:..:.|:.|::  ||....|:.|  |.|:|.
  Fly    68 GAKPGEPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLT--DERIREKFKLLKELLQLP 130

Human  2208 KYADKPAGTYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGR-SVVL 2271
            . |.:.....|||.:|:||.|.|:|..|..:.|||||.|:||..|..:|:.:::..:..: :|::
  Fly   131 P-ARQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVII 194

Human  2272 TSHSMEEC-EALCTRLAIMVNGRLRCLGSIQHLKNRFG-----DGYMITVRTKSSQSVKDVVRFF 2330
            |:|.:||. :|.|  :.:|.||.|....:..::..:||     |.::|..:.:.::.....:...
  Fly   195 TTHYIEEAKQANC--IGLMRNGVLLAEDTPTNIMIKFGTQSIEDAFLILSQRQGNEDELAQIMDH 257

Human  2331 NRN--FPEAMLK-----------------------ERHHTKVQYQLKSEHISL-----AQVFSKM 2365
            |:|  .|.|:|.                       ..:..|:.:..|....:|     .|:|   
  Fly   258 NKNQALPAAVLPPEVIDTHEPNMPEKQPIPFEEPLNENRKKIFFTTKGRVKALMTKNFVQLF--- 319

Human  2366 EQVSGVLGIEDYSVSQTTLDNVFV-----------------NFAKKQSDNL--EQQETEPPSALQ 2411
            .|.||::.:..:.:.|.|...:.:                 |:.:...:||  ..::::..|.|.
  Fly   320 RQPSGIIFMLLFPIIQLTCFYLAIGKTPTNLEIGVYSGEVENYGECFDENLVTVYKDSDNESCLF 384

Human  2412 SPLGC-LLSLLRPRSAPTELRALVADEPED--------------------LDTEDEGLISFE--E 2453
            :.|.| .:.:|....|..:..|..||...|                    |...::|:.|.:  .
  Fly   385 NKLSCRYIRVLGDDVATRKYYASEADALNDAKRATTVGYLHFAQNFSDSILSVMEDGIHSSDGAV 449

Human  2454 ERAQLSFNTD 2463
            :.|:||.:.|
  Fly   450 DHAELSIHID 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABCA2NP_997698.1 rim_protein 58..2398 CDD:130324 94/373 (25%)
ABC_subfamily_A 1021..1240 CDD:213230
ABC_subfamily_A 2081..2304 CDD:213230 74/227 (33%)
CG11147NP_608954.1 CcmA 1..282 CDD:224054 83/283 (29%)
P-loop_NTPase 4..222 CDD:304359 74/223 (33%)
ABC2_membrane_3 322..702 CDD:289468 24/138 (17%)
ABC2_membrane 469..664 CDD:279410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.