DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and AAD14

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_014068.1 Gene:AAD14 / 855385 SGDID:S000005275 Length:376 Species:Saccharomyces cerevisiae


Alignment Length:318 Identity:57/318 - (17%)
Similarity:112/318 - (35%) Gaps:103/318 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ETGFRHFDTAYYYENEKE---IGEALRTQIKMGNISRENIFLTTKLWNTH--------------- 119
            |.|....|||..|:||:.   |||.:.:: |:    |:.|.:.||....:               
Yeast    64 EAGGNCIDTANSYQNEESEIWIGEWMASR-KL----RDQIVIATKFTGDYKKYEVGGGKSANYCG 123

  Fly   120 HDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGDELQTVEIDYLDTWRAMEN 184
            :..|.:.......|..|...:||:..:|:                .|.:.::| :.:|   ::..
Yeast   124 NHKRSLHVSVRDSLRKLQTDWIDILYIHW----------------WDYMSSIE-EVMD---SLHI 168

  Fly   185 LVKLGMVRSIGLSN--------------------FNMEQIQRIIQCSSSKPVVNQVEIWPGFLQK 229
            ||:.|.|..:|:|:                    |::.|        ....|:|:      ..::
Yeast   169 LVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSVYQ--------GKWNVLNR------DFER 219

  Fly   230 DLVDYCRYNGIIVTAFSPLG----------QPNRKNHCPVYFF-------------SEGMKRLVK 271
            |::...|:.|:.:..:..:|          :..:||...:..|             ||.:.::.:
Yeast   220 DIIPMARHFGMALAPWDVMGGGRFQSKKAMEERKKNGEGLRTFVGGPEQTELEVKISEALTKIAE 284

  Fly   272 KY-KRSASQIVLRYLID--YGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKP 326
            :: ..|.:.|.:.|:..  ..|.|:.......|:|:|:.....||.......|..|.|
Yeast   285 EHGTESVTAIAIAYVRSKAKNVFPLIGGRKIEHLKQNIEALSIKLTPEQIEYLESIVP 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 57/318 (18%)
Tas 50..324 CDD:223739 55/314 (18%)
AAD14NP_014068.1 AKR_AKR9A3_9B1-4 20..338 CDD:381373 54/312 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345925
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.