DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and YJR096W

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_012630.1 Gene:YJR096W / 853559 SGDID:S000003857 Length:282 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:100/295 - (33%)
Similarity:163/295 - (55%) Gaps:40/295 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 MAPK-VRLSSGHEMPVLGFGTYKLRGYQCSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIK 100
            |.|| .:||:|.::|.:..|||.:...|.:..|:..::.|:||||||..|.||||:|:.:   ||
Yeast     1 MVPKFYKLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGI---IK 62

  Fly   101 M-----GNISRENIFLTTKLWNTHHDPRDVRRICEKQL-ELLGFSYIDLYLMHFPVGYKYVCDEI 159
            .     ||..||.||.||||||:.:..:..:....:.| |:.|..||||.|:|            
Yeast    63 WLNEDPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIH------------ 115

  Fly   160 LMPMSGDELQTVEIDYLDTWRAMENLVKLGMVRSIGLSNFNMEQIQRIIQCS--SSKPVVNQVEI 222
             .|:.|.:|:      |:|||||:..|..|:|:|||:||:..:.|..::...  ..||||||:||
Yeast   116 -SPLEGSKLR------LETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPELKHKPVVNQIEI 173

  Fly   223 WPGFLQKDLVDYCRYNGIIVTAFSPLGQPNRKNHCPVY-FFSEGMKRLVKKYKRSASQIVLRYLI 286
            .|..::::|.|||:..|::|.||:||        |..| ..:..:.::.|:..|:..|:::|:.:
Yeast   174 SPWIMRQELADYCKSKGLVVEAFAPL--------CHGYKMTNPDLLKVCKEVDRNPGQVLIRWSL 230

  Fly   287 DYGVVPIPKAANPIHIKENLNIFDFKLDEADTRLL 321
            .:|.:|:||......::.||..::|:|.:...:.|
Yeast   231 QHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 100/295 (34%)
Tas 50..324 CDD:223739 94/281 (33%)
YJR096WNP_012630.1 AKR_AKR1-5-like 14..266 CDD:381297 94/282 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.