DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and ARA1

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_009707.3 Gene:ARA1 / 852446 SGDID:S000000353 Length:344 Species:Saccharomyces cerevisiae


Alignment Length:331 Identity:108/331 - (32%)
Similarity:175/331 - (52%) Gaps:56/331 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TSNIVEDNSQVAVILGGNQNTQCGEKALLMAPKV-----RLSSGHEMPVLGFGT----YKLRGYQ 63
            |.||||:                     ::.||.     .|::|..:|.||.||    .||.  :
Yeast     8 TENIVEN---------------------MLHPKTTEIYFSLNNGVRIPALGLGTANPHEKLA--E 49

  Fly    64 CSAAVHCAIETGFRHFDTAYYYENEKEIGEALRTQIKMGNISRENIFLTTKLWNTHHDPRDVRRI 128
            ...||..||:.|:||.|||:.||.|..:|||::..::.|:|.||::|:|||:|....|  :|.|.
Yeast    50 TKQAVKAAIKAGYRHIDTAWAYETEPFVGEAIKELLEDGSIKREDLFITTKVWPVLWD--EVDRS 112

  Fly   129 CEKQLELLGFSYIDLYLMHFPVGYKYVCDE------ILMPM--SGDELQTVEIDYLDTWRAMENL 185
            ..:.|:.||..|:||.|.|:|:.::.:.|.      :..|:  ||..:...:.|||:|::.:|.:
Yeast   113 LNESLKALGLEYVDLLLQHWPLCFEKIKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKI 177

  Fly   186 V---KLGMVRSIGLSNFNMEQIQRIIQCSSSKPVVNQVEIWPGFLQKDLVDYCRYNGIIVTAFSP 247
            .   ....||:||:|||::|.::|:|:....||.|||||..|...|.:|..:|..:.|::||:||
Yeast   178 YLDPNDHRVRAIGVSNFSIEYLERLIKECRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSP 242

  Fly   248 LGQ---PNRKNHCPVYFFSEGMKRLVKKYKRSASQIVLRYLIDYGVVPIPKAANPIHIKENLNIF 309
            ||.   ||.|  .|:      :|:|.:||..:.:.:::.|.|..|.:.||::.||:.|..::...
Yeast   243 LGSHGAPNLK--IPL------VKKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFA 299

  Fly   310 DFKLDE 315
            ....||
Yeast   300 SLTKDE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 103/302 (34%)
Tas 50..324 CDD:223739 99/284 (35%)
ARA1NP_009707.3 AKR_AKR3C1 22..321 CDD:381345 101/296 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0656
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100072
Panther 1 1.100 - - O PTHR11732
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.