DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARY and AAD3

DIOPT Version :9

Sequence 1:NP_001163844.1 Gene:ARY / 19988923 FlyBaseID:FBgn0058064 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_010032.1 Gene:AAD3 / 850471 SGDID:S000000704 Length:363 Species:Saccharomyces cerevisiae


Alignment Length:321 Identity:58/321 - (18%)
Similarity:108/321 - (33%) Gaps:109/321 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ETGFRHFDTAYYYENEKE---IGE-----ALRTQI-------------KMGNISRENIFLTTKLW 116
            |.|....|.|...:||:.   |||     .||.||             |.|..:..| :......
Yeast    61 EAGGNFIDAANNCQNEQSEEWIGEWIQSRRLRDQIVIATKFIKSDKKYKAGESNTAN-YCGNHKR 124

  Fly   117 NTHHDPRDVRRICEKQLELLGFSYIDLYLMHFPVGYKYVCDEILMPMSGDELQTVEIDYLDTWRA 181
            :.|...||       .|..|...:||:..:|:                .|.:.::| :::|   :
Yeast   125 SLHVSVRD-------SLRKLQTDWIDILYVHW----------------WDYMSSIE-EFMD---S 162

  Fly   182 MENLVKLGMVRSIGLSN--------------------FNMEQIQRIIQCSSSKPVVNQVEIWPGF 226
            :..||:.|.|..:|:|:                    |::.|        ....|:|:      .
Yeast   163 LHILVQQGKVLYLGVSDTPAWVVSAANYYATSYGKTPFSIYQ--------GKWNVLNR------D 213

  Fly   227 LQKDLVDYCRYNGIIVTAFSPLG----------QPNRKNHCPVYFF-------------SEGMKR 268
            .::|::...|:.|:.:..:..:|          :..|||...:..|             ||.:.:
Yeast   214 FERDIIPMARHFGMALAPWDVMGGGRFQSKKAMEERRKNGEGIRSFVGASEQTDAEIKISEALAK 278

  Fly   269 LVKKY-KRSASQIVLRYLID--YGVVPIPKAANPIHIKENLNIFDFKLDEADTRLLRGIKP 326
            :.::: ..|.:.|.:.|:..  ....|..:......:|||:......|...:.:.|..|.|
Yeast   279 IAEEHGTESVTAIAIAYVRSKAKNFFPSVEGGKIEDLKENIKALSIDLTPDNIKYLESIVP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARYNP_001163844.1 ARA1 37..332 CDD:223729 58/321 (18%)
Tas 50..324 CDD:223739 56/317 (18%)
AAD3NP_010032.1 AKR_AKR9A3_9B1-4 17..335 CDD:381373 55/315 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345930
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.